Gene Information

Name : Desaf_0871 (Desaf_0871)
Accession : YP_005050878.1
Strain : Desulfovibrio africanus Walvis Bay
Genome accession: NC_016629
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 949122 - 949805 bp
Length : 684 bp
Strand : +
Note : KEGG: dvl:Dvul_1911 two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence :
ATGGCCAAGGAAACGATACTTATCGTCGAGGACGACGAGGATATCCTGCAGCTCATCAAGTTCAATGTCGAAAGCGCGGG
ATATGACGCCATCACGGCCAGCGACGGGCTGGAAGCCCTGAACAAGGCCCGGCGTCACATGCCGGACCTGATCCTGTTGG
ATCTCATGCTGCCCGGAATGGACGGCTTCGAGGTATGCAAGGAACTCAAGCGCGGCTCGGAGACGGGCCGGATTCCCATC
CTCATGCTTACGGCGCGCGGCGAGGAAGTGGACCGCATCGTGGGGCTGGAGCTAGGCGCCGACGACTACGTGGTCAAGCC
TTTCAGCCCGCGGGAAATCATCTTGCGCGTGCGCGCCGTGCTGCGGCGCAACAAGGGTGAGGAGGACGTCCGCCAGAGCT
GGCGCCGCGAGAGGCTCAGCGTGGACATGGAAGCGCACAGGGCGGAGATCGACGACCAGGAGCTGCTGCTCACGGCCACG
GAGTTCAAGCTGCTGTCCGAACTCATCCGCAATCCCGGCCGGGTGCTGACCCGCGAACAGCTTTTGAACACCGTCTGGGG
CTACGAGTTCGAAGGATACGCCCGCACGGTGGACACGCACGTGCGCAGGCTGCGCCAGAAGCTCGGTGACTACGCCAAGT
TCGTGGAGACAGTACGCGGCGTGGGCTACAGGTTCAAAGAGTAG

Protein sequence :
MAKETILIVEDDEDILQLIKFNVESAGYDAITASDGLEALNKARRHMPDLILLDLMLPGMDGFEVCKELKRGSETGRIPI
LMLTARGEEVDRIVGLELGADDYVVKPFSPREIILRVRAVLRRNKGEEDVRQSWRRERLSVDMEAHRAEIDDQELLLTAT
EFKLLSELIRNPGRVLTREQLLNTVWGYEFEGYARTVDTHVRRLRQKLGDYAKFVETVRGVGYRFKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-24 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 4e-40 47
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 4e-40 47
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 4e-40 47
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 4e-40 47
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 4e-40 47
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 4e-40 47
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 4e-40 47
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 4e-40 47
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 4e-40 47
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 4e-40 47
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 3e-34 47
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 3e-38 44
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 6e-37 44
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 1e-29 44
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 9e-29 44
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family BAC0039 Protein 2e-29 44
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 7e-30 44
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 3e-28 44
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family BAC0596 Protein 9e-29 44
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 2e-29 44
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-34 43
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 6e-23 43
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family BAC0197 Protein 8e-26 43
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_008702.1.4607594. Protein 1e-30 42
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family AF310956.2.orf0.gene Protein 9e-25 41
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family AE016830.1.gene2255. Protein 1e-25 41
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family U35369.1.gene1.p01 Protein 1e-25 41
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-30 41
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-30 41
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-30 41
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-30 41
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-30 41
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-30 41
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-30 41
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-30 41
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family CP004022.1.gene1676. Protein 3e-29 41
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 5e-30 41
Desaf_0871 YP_005050878.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 6e-23 41