Gene Information

Name : BYI23_B007850 (BYI23_B007850)
Accession : YP_005042279.1
Strain :
Genome accession: NC_016625
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 905981 - 906694 bp
Length : 714 bp
Strand : +
Note : -

DNA sequence :
ATGAAAGTCCTGATAGTCGAAGACGAACATAAAGTGGTGGATTACCTGCGCTCGGGGTTGACCGAGCAAGGCTGGGTCGT
CGATGTCGCGATGGACGGCGAGGAAGGCACGCATCTCGCCATCGAATACGACTACGACGTGATCGTGCTGGACGTCATGC
TGCCAAGACGCGACGGCTTCGCGGTGCTGAAGGCGCTGCGCATGCAGAAGTCCACGCCCGTCATCATGCTCACCGCGCGC
GATCACATCAACGATCGCGTGCGCGGCTTGCGCGAAGGCGCGGACGATTATCTGACCAAGCCCTTCTCGTTCCTCGAACT
GGTCGAGCGGCTGCACGCGCTCGCGCGCCGCACGCGCGCGCAGGAATCCACGCTCATCTCCGTGGGCGATCTGTATGTCG
ATCTGATCGGCCGCCGCGCCACGCGCGATGGCGTGCGGCTCGATCTCACCGCGAAAGAGTTTCAACTGCTCTCCGTGCTC
GCGCGCCGTCACGGCGATATCCTGTCGAAGACCGCGATCACCGAACTCGTCTGGGAAGTCGATTTCGAAAGCCACACGAA
TGTCGTCGAAACGGCGATCAAGCGTTTGCGCGCGAAACTCGACGGACCGTTCCGCACGAAACTGCTGCATACCGTGCGCG
GCATGGGCTACGTGCTCGAAGTGCGCGAAGTCCGCGACACGCGCGACGCCAGGGAAGACGCGAGACCATCATGA

Protein sequence :
MKVLIVEDEHKVVDYLRSGLTEQGWVVDVAMDGEEGTHLAIEYDYDVIVLDVMLPRRDGFAVLKALRMQKSTPVIMLTAR
DHINDRVRGLREGADDYLTKPFSFLELVERLHALARRTRAQESTLISVGDLYVDLIGRRATRDGVRLDLTAKEFQLLSVL
ARRHGDILSKTAITELVWEVDFESHTNVVETAIKRLRAKLDGPFRTKLLHTVRGMGYVLEVREVRDTRDAREDARPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-49 51
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-48 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 2e-56 55
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 1e-57 54
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 6e-52 52
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 2e-52 50
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 5e-44 50
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 2e-51 48
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 3e-47 47
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 4e-29 41
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 2e-31 41
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-32 41
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 4e-32 41
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 4e-32 41
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 4e-32 41
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 4e-32 41
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 4e-32 41
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 3e-32 41
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 4e-32 41
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-32 41
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 4e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 1e-49 51
BYI23_B007850 YP_005042279.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 2e-37 50