Gene Information

Name : arsC2 (AZOLI_0923)
Accession : YP_005038503.1
Strain : Azospirillum lipoferum 4B
Genome accession: NC_016622
Putative virulence/resistance : Resistance
Product : arsenate reductase (Arsenical pump modifier)
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 852045 - 852386 bp
Length : 342 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 8674982, 8674982; Product type e : enzyme

DNA sequence : 
ATGAGCGACGTGACGATCTACCACAACCCGCGCTGCAGCAAATCGCGCGAGACGCTGGACCTCCTGCGCTCCCGCGGCGT
CGAACCGGCGGTGGTGGAGTATCTGAAGACCCCGCCCAGCCCGGCGGAGCTGTCCGCCATCCTCGCCAAGCTGGGCAAGG
GTCCGCGCGACATCACCCGCGCCAAGGAGGCGGCGGAGGCCGGCTTGCCCAAGGATCTGGACGGCGAGGCGCTGATCGCC
GCCCTGTCGGCCAATCCGTCCGCCATCGAACGCCCCATCGTGGTGAAGGGCGACCGCGCCCGCGTCGGCCGTCCGCCGGA
GTCGGTGCTGGACCTCCTCTGA

Protein sequence : 
MSDVTIYHNPRCSKSRETLDLLRSRGVEPAVVEYLKTPPSPAELSAILAKLGKGPRDITRAKEAAEAGLPKDLDGEALIA
ALSANPSAIERPIVVKGDRARVGRPPESVLDLL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 9e-18 44
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 2e-16 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
arsC2 YP_005038503.1 arsenate reductase (Arsenical pump modifier) BAC0584 Protein 8e-19 44
arsC2 YP_005038503.1 arsenate reductase (Arsenical pump modifier) BAC0583 Protein 2e-19 44
arsC2 YP_005038503.1 arsenate reductase (Arsenical pump modifier) BAC0585 Protein 7e-19 44
arsC2 YP_005038503.1 arsenate reductase (Arsenical pump modifier) BAC0582 Protein 1e-18 42