Gene Information

Name : AZOBR_p220102 (AZOBR_p220102)
Accession : YP_005033156.1
Strain :
Genome accession: NC_016618
Putative virulence/resistance : Resistance
Product : putative Beta-lactamase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 315105 - 315995 bp
Length : 891 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId : 8834913, 9210666; Product type pe : putative enzyme

DNA sequence :
ATGATCGGACGGCGGGCTTTCCTGGCCGCGGCGGGCGGCATGACGGTGCTGGCGGCGACCCGCGTGAGGGCGGAGAAACC
CAGGAACTTCGGGGACAAGCGGCTGGCCGACGCGATCGCCTCGCTGGAAAAGCGCAGCGGCGGGCGGCTCGGCGTGGCGG
TGCTCGACACCGGCACCGGGCAGCGCTTCGGGCATCGCGCGGACGAGCGCTTCCCGATGTGCAGCACCTTCAAATTTCTT
TTGGCTGGCGCCGTCCTGAAGCGGGTGGACGAGGGACGCGAGCGGCTGGACCGGCGCATCCCGGTGACCAAGGCGGACAT
GGTCCCATACGCCCCCTTCGCCGAAACCCGCCTCGACGGCCCACCCCCGACGGTGGCCGAACTGTGCGAGGCGACGATGA
CGCTCAGCGACAATGTGGCGGCGAACCTGCTGCTGCCGGCGGTGGGCGACCCCGCCGGGCTGACCGCCTTCCTGCGCACG
CTGGGCGACCAAAAGACCCGGCTGGACCGCAACGAGCCGTCCCTGAACAGCGCCATTCCCGGCGACCCGCGCGACACCAC
CACGCCCGCGGCGATGGTCCACAGCATGGAGCGGCTGATGCTGGGCGACGCGCTGACCCCGGCATCGCGCGAGCAGCTCA
TCGCCTGGATGGTCGCCAACCGGACCGGCGACAAGCGGCTGCGCGCCGGCCTGCCGAAGGGCTGGCGCGTCGGCGACAAG
ACCGGCACCGGCGTGCGCGGGACGGCCAACGACATCGGCATCGTCTGGCCGGAGGGGAGGGCGCCGCTGCTGATTACCAG
CTACCTGACCGAAACGCCCGACGCCTTCAAGGAACGGGACGCCATCCACGCCGGCGTGGCGCGGGCGGTGGCCGACGCGC
TCAAGGGCTGA

Protein sequence :
MIGRRAFLAAAGGMTVLAATRVRAEKPRNFGDKRLADAIASLEKRSGGRLGVAVLDTGTGQRFGHRADERFPMCSTFKFL
LAGAVLKRVDEGRERLDRRIPVTKADMVPYAPFAETRLDGPPPTVAELCEATMTLSDNVAANLLLPAVGDPAGLTAFLRT
LGDQKTRLDRNEPSLNSAIPGDPRDTTTPAAMVHSMERLMLGDALTPASREQLIAWMVANRTGDKRLRAGLPKGWRVGDK
TGTGVRGTANDIGIVWPEGRAPLLITSYLTETPDAFKERDAIHAGVARAVADALKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
blaTEM AFV53104.1 TEM-1 beta-lactamase Not tested AbGRI2-1 Protein 3e-49 49
ABTW07_3874 YP_005797122.1 beta-lactamase TEM Not tested AbaR4e Protein 4e-49 49
blaTEM-1b ACK44542.1 BlaTEM-1b beta lactamase Not tested SGI1 Protein 3e-49 49
blaTEM-1b ACF06168.1 beta-lactamase TEM-1b Not tested Tn5036-like Protein 3e-49 49
blaTEM-1 ADI24150.1 beta-lactamase TEM-1 Not tested AbaR1 Protein 3e-49 49
blaTEM-1b AGK07035.1 TEM-1b beta lactamase Not tested SGI1 Protein 3e-49 49
blaTEM-1b AGK07093.1 TEM-1b beta lactamase Not tested SGI1 Protein 3e-49 49
blaCTX-M2 ACF06162.1 beta-lactamase CTX-M2 Not tested Tn5036-like Protein 5e-59 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY034847.1.gene1.p01 Protein 4e-51 52
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EU729727.1.gene1.p1 Protein 4e-51 52
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF395881.gene.p01 Protein 3e-51 52
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ663489.gene.p01 Protein 1e-56 51
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY005110.1.gene1.p1 Protein 1e-56 51
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ328639.gene.p01 Protein 1e-56 51
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase FJ234412.1.gene1.p01 Protein 2e-50 51
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase GQ140348.1.gene1.p01 Protein 2e-50 51
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HQ641421.1.gene1.p01 Protein 7e-51 51
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HM066995.1.gene1.p01 Protein 4e-50 51
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF297554.1.gene1.p1 Protein 9e-51 51
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EU555534.1.gene1.p01 Protein 2e-50 51
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY130285.1.gene1.p1 Protein 1e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY130284.1.gene1.p1 Protein 1e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EF418608.1.gene1.p01 Protein 5e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY598759.gene.p01 Protein 2e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HQ398215.1.gene1.p01 Protein 4e-60 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase FJ907381.1.gene1.p01 Protein 2e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HQ166709.1.gene1.p01 Protein 7e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EF219142.1.gene1.p01 Protein 2e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM411407.1.gene1.p01 Protein 3e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase FJ214366.1.gene1.p1 Protein 1e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY292654.1.gene1.p1 Protein 1e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF305837.gene.p01 Protein 2e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase FJ214369.1.gene1.p1 Protein 2e-60 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY847146.1.gene1.p01 Protein 2e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF174129.3.gene9.p01 Protein 4e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF252623.2.gene1.p01 Protein 6e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY267213.1.gene1.p01 Protein 1e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HQ398214.1.gene1.p01 Protein 2e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase FJ214367.1.gene1.p1 Protein 1e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY649755.1.gene1.p01 Protein 1e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HM755448.1.gene1.p01 Protein 2e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF325134.1.gene1.p1 Protein 4e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY847143.1.gene1.p01 Protein 1e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HQ833652.1.gene1.p01 Protein 9e-60 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY847144.1.gene1.p01 Protein 1e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ256091.1.gene1.p1 Protein 4e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY995206.gene.p01 Protein 1e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF255298.1.gene1.p1 Protein 2e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase JF274247.1.gene1.p01 Protein 6e-60 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase FJ214368.1.gene1.p1 Protein 3e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HM803271.1.gene1.p01 Protein 9e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AJ704396.1.gene1.p01 Protein 2e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF325133.1.gene1.p1 Protein 1e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY033516.1.gene2.p01 Protein 3e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY822595.1.gene1.p01 Protein 4e-60 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase FJ873739.1.gene1.p01 Protein 4e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EU202673.2.gene1.p2 Protein 1e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY156923.1.gene1.p01 Protein 1e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY029068.1.gene1.p1 Protein 3e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY238472.1.gene1.p01 Protein 1e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY847147.1.gene1.p01 Protein 2e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AJ416345.gene.p01 Protein 4e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AB177384.1.gene1.p01 Protein 1e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EF581888.1.gene1.p01 Protein 1e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase JF274243.1.gene1.p01 Protein 5e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase Y10278.1.gene1.p01 Protein 1e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HQ833651.1.gene1.p01 Protein 8e-60 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY143430.1.gene1.p01 Protein 3e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EU177100.1.gene1.p01 Protein 2e-58 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF252622.2.gene2.p01 Protein 1e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase JF274246.1.gene1.p01 Protein 4e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase JF274242.1.gene1.p01 Protein 5e-59 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EF136377.1.gene1.p01 Protein 5e-50 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF397066.1.gene1.p1 Protein 9e-50 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ834729.1.gene1.p1 Protein 1e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HQ529916.1.gene1.p01 Protein 1e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY368237.1.gene1.p1 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF190692.1.gene1.p01 Protein 8e-50 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase Y10280.1.gene1.p01 Protein 1e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase NC_010558.1.6276043. Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase Y17582.1.gene1.p01 Protein 1e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF190693.1.gene1.p01 Protein 1e-50 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF516719.1.gene1.p1 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase GU371926.1.gene94.p0 Protein 3e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF091113.2.gene1.p01 Protein 8e-50 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY271267.1.gene1.p01 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF347054.1.gene1.p1 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ286729.1.gene1.p1 Protein 9e-50 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase X54606.1.gene1.p01 Protein 1e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM087454.1.gene1.p01 Protein 1e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF427128.1.gene1.p01 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase FJ873740.1.gene1.p01 Protein 3e-50 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase Y14574.2.gene1.p01 Protein 3e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY072920.1.gene1.p1 Protein 5e-50 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF468003.1.gene1.p1 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM183304.1.gene1.p01 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF397067.1.gene1.p1 Protein 9e-50 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase Y10281.1.gene1.p01 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EU274580.1.gene1.p1 Protein 1e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase FQ312006.1.gene118.p Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AJ277414.1.gene1.p01 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase FJ197316.1.gene1.p1 Protein 8e-50 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase Y10279.1.gene1.p01 Protein 1e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF427130.1.gene1.p01 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase JN416112.1.gene1.p01 Protein 2e-50 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase NC_011586.7045197.p0 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY628176.1.gene1.p01 Protein 1e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF516720.1.gene1.p1 Protein 1e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF427129.1.gene1.p01 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ105528.2.gene1.p01 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF351241.1.gene1.p01 Protein 7e-50 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ834728.1.gene1.p1 Protein 1e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM941159.1.gene1.p01 Protein 3e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase FJ405211.1.gene1.p01 Protein 8e-50 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF104442.1.gene1.p01 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY589493.1.gene1.p01 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF190695.1.gene1.p01 Protein 9e-50 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ105529.2.gene1.p01 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF397068.1.gene1.p1 Protein 3e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase FJ919776.1.gene1.p01 Protein 4e-50 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AJ277415.1.gene1.p01 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HQ451074.1.gene4.p01 Protein 2e-49 49
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HM776707.1.gene1.p1 Protein 1e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY037780.1.gene1.p01 Protein 2e-52 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EF210159.1.gene1.p01 Protein 1e-57 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AB205197.1.gene1.p01 Protein 6e-57 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ268764.2.gene6.p01 Protein 7e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ885477.1.gene1.p01 Protein 2e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ061159.1.gene1.p01 Protein 5e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EU136031.3.gene1.p3 Protein 5e-59 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY847145.1.gene1.p01 Protein 2e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase FJ815436.1.gene1.p01 Protein 2e-57 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HQ913565.1.gene1.p01 Protein 3e-59 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AJ549244.1.gene1.p01 Protein 2e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase GQ351346.1.gene1.p01 Protein 4e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY847148.1.gene1.p01 Protein 1e-57 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EF426798.1.gene1.p1 Protein 3e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AJ557142.gene.p01 Protein 2e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ223685.1.gene1.p01 Protein 7e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ211987.1.gene1.p01 Protein 7e-59 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EU545409.1.gene1.p1 Protein 3e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ810789.1.gene1.p01 Protein 2e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AB284167.2.gene1.p01 Protein 6e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase X92506.gene.p01 Protein 2e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY515297.1.gene1.p1 Protein 3e-57 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EU402393.1.gene1.p1 Protein 2e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase JN227085.1.gene1.p01 Protein 5e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY080894.1.gene1.p01 Protein 2e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase JF966749.1.gene1.p01 Protein 3e-58 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY750914.gene.p01 Protein 7e-57 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM087453.1.gene1.p01 Protein 2e-49 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM176550.2.gene1.p01 Protein 6e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EU032604.1.gene1.p01 Protein 3e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF227204.1.gene1.p01 Protein 5e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ174305.1.gene1.p01 Protein 6e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase FJ668814.gene1.p01 Protein 5e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM176558.2.gene1.p01 Protein 5e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY259119.1.gene1.p1 Protein 7e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY528718.1.gene1.p01 Protein 2e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF535130.1.gene1.p01 Protein 8e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase JF812965.1.gene1.p01 Protein 7e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase JN051143.1.gene1.p01 Protein 2e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HQ637576.1.gene1.p01 Protein 5e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EU274581.1.gene1.p1 Protein 2e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EU155018.1.gene1.p01 Protein 9e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF148850.1.gene1.p01 Protein 5e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF299299.1.gene1.p01 Protein 5e-50 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY956335.1.gene1.p1 Protein 2e-49 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HM246246.1.gene1.p1 Protein 1e-49 48
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AJ920369.1.gene1.p01 Protein 2e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM176556.2.gene1.p01 Protein 3e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AJ866285.2.gene1.p01 Protein 2e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ322460.1.gene1.p1 Protein 3e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ193536.1.gene1.p01 Protein 5e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM176552.2.gene1.p01 Protein 9e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ174308.1.gene1.p01 Protein 4e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM176557.2.gene1.p01 Protein 3e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase JX268752.1.gene1.p01 Protein 3e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EF373971.1.gene1.p01 Protein 5e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM176549.2.gene1.p01 Protein 3e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HQ661362.1.gene1.p1 Protein 6e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF467947.1.gene1.p1 Protein 3e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AB302939.1.gene1.p01 Protein 3e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY277255.2.gene1.p01 Protein 4e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF467948.1.gene1.p1 Protein 6e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase JQ029959.1.gene1.p01 Protein 3e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF208796.2.gene1.p01 Protein 5e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ836922.1.gene1.p01 Protein 2e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ174304.1.gene1.p01 Protein 4e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HM751100.1.gene1.p01 Protein 6e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase CP000647.1.gene1607. Protein 3e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF535128.1.gene1.p01 Protein 5e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AJ866284.2.gene1.p01 Protein 3e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase GQ428198.1.gene1.p01 Protein 6e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM176551.2.gene1.p01 Protein 3e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY303807.gene.p01 Protein 5e-57 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF488377.1.gene1.p1 Protein 1e-57 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF189721.1.gene1.p01 Protein 3e-56 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM176548.2.gene1.p01 Protein 1e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EF373972.1.gene1.p01 Protein 2e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase JX268631.1.gene1.p01 Protein 2e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EU024485.1.gene1.p01 Protein 1e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY079099.1.gene1.p01 Protein 8e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ054528.1.gene1.p01 Protein 1e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY263404.1.gene1.p1 Protein 6e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HQ661363.1.gene1.p1 Protein 1e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM176553.2.gene1.p01 Protein 1e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY518560.gene.p01 Protein 1e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM176547.2.gene1.p01 Protein 2e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY288915.1.gene1.p01 Protein 6e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EF373973.1.gene1.p01 Protein 9e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase X55640.1.gene1.p01 Protein 1e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY210887.1.gene1.p1 Protein 2e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF226622.1.gene1.p01 Protein 3e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF148851.1.gene1.p01 Protein 1e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AB023477.1.gene1.p01 Protein 1e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EU342351.1.gene1.p01 Protein 7e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF293345.1.gene1.p01 Protein 1e-49 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase U92041.1.gene1.p01 Protein 8e-50 47
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY157676.1.gene1.p01 Protein 4e-56 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ023162.1.gene1.p1 Protein 2e-55 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EF373970.1.gene1.p01 Protein 6e-50 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EU418913.1.gene1.p01 Protein 9e-50 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM176555.2.gene1.p01 Protein 4e-50 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HM559945.1.gene1.p01 Protein 8e-50 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EF373969.1.gene1.p01 Protein 1e-49 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY070258.1.gene1.p1 Protein 2e-49 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EU586041.1.gene1.p01 Protein 6e-50 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HQ877615.1.gene1.p01 Protein 1e-49 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF164577.1.gene1.p01 Protein 8e-50 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ174306.1.gene1.p01 Protein 1e-49 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ328802.1.gene1.p01 Protein 1e-49 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM176554.2.gene1.p01 Protein 6e-50 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase X98102.1.gene1.p01 Protein 8e-50 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ013287.1.gene1.p1 Protein 9e-50 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ174307.1.gene1.p01 Protein 1e-49 46
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AJ567481.1.gene1.p01 Protein 3e-59 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ125241.gene.p01 Protein 3e-59 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ408762.1.gene1.p1 Protein 1e-58 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase EF374097.1.gene1.p01 Protein 2e-59 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase DQ102702.1.gene1.p1 Protein 6e-59 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase X92507.1.gene1.p01 Protein 3e-59 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase GQ149244.1.gene1.p01 Protein 2e-59 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase GU127598.1.gene1.p1 Protein 4e-59 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY954516.1.gene1.p1 Protein 1e-55 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AM982522.2.gene1.p01 Protein 7e-57 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase HM167760.1.gene1.p01 Protein 4e-56 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase FJ971899.1.gene1.p1 Protein 2e-55 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF518567.2.gene4.p01 Protein 2e-55 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase GQ870432.1.gene1.p1 Protein 1e-55 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AF135373.1.gene1.p01 Protein 2e-55 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AY178993.1.gene1.p01 Protein 1e-55 45
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase U95364.1.gene1.p01 Protein 1e-58 44
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AJ416344.1.gene1.p01 Protein 1e-58 44
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase GQ149243.1.gene1.p01 Protein 1e-58 44
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase Y14156.1.gene1.p01 Protein 1e-56 44
AZOBR_p220102 YP_005033156.1 putative Beta-lactamase AJ005045.gene.p01 Protein 5e-57 43