Gene Information

Name : phoB (AZOBR_10241)
Accession : YP_005029938.1
Strain : Azospirillum brasilense Sp245
Genome accession: NC_016617
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with PhoR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 223592 - 224296 bp
Length : 705 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 1447208, 2993631, 3881386; Product type r : regulator

DNA sequence :
ATGAATTCGGCGCTGAAGCCGCTCGTTCTCATCGTCGAGGACGAAGCCGACATCGTGACGCTGCTGAAGTACAATCTGGA
GAAGGAAGGCTTCCGCGTGAACGCCGCAACCGACGGCGAGGAGGCCCTTCTGCTGGCCGGCGAGCAGACGCCGAACATCG
TCCTGCTCGACTGGATGCTGCCGCTGATGTCGGGCCTGGAGGTCTGCCGCCAGATGCGCCGCAACAGCAAGATGCGCGAC
ATCCCGATCATCATGCTGACCGCCCGCGGCGAGGAGGCGGACCGCGTGCGCGGCCTGAATTCCGGCGCCGACGACTACAT
CACCAAGCCCTTCTCCCCGACCGAGCTGGTCGCCCGCATGCGCGCCGTGCTGCGCCGCTCAGCCCCTGGCATGACCGACG
AGACTCTGCAGTTCGCCGATGTGACCATGGATCTGGCCGCCCACCGGGTGCGCCGGAACGGGCGCGACGTGCATCTGGGG
CCGACCGAGTTCCGCCTGCTGCGCCATTTCATGCAGCACCCCGGCCGTGTCTTCTCGCGCGAGCAGCTTCTCGACGTGGT
GTGGGGCCATGACGTCTATGTCGAGCCGCGCACCGTTGACGTGCACATCCGCCGCCTGCGCAAGGCGATGAACGAGGAGA
CGGAGATGGACCTGATCCGCACCGTCCGCTCGGCCGGCTACGCGCTGGACAGCAAGTCCATCTGA

Protein sequence :
MNSALKPLVLIVEDEADIVTLLKYNLEKEGFRVNAATDGEEALLLAGEQTPNIVLLDWMLPLMSGLEVCRQMRRNSKMRD
IPIIMLTARGEEADRVRGLNSGADDYITKPFSPTELVARMRAVLRRSAPGMTDETLQFADVTMDLAAHRVRRNGRDVHLG
PTEFRLLRHFMQHPGRVFSREQLLDVVWGHDVYVEPRTVDVHIRRLRKAMNEETEMDLIRTVRSAGYALDSKSI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-36 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR AE000516.2.gene3505. Protein 4e-37 45
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR NC_010410.6002989.p0 Protein 3e-36 44
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR NC_010400.5986590.p0 Protein 1e-35 44
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR NC_011595.7057856.p0 Protein 3e-36 44
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR NC_002952.2859905.p0 Protein 5e-43 44
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR NC_007793.3914279.p0 Protein 8e-43 44
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR NC_007622.3794472.p0 Protein 5e-43 44
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR NC_002745.1124361.p0 Protein 8e-43 44
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR NC_009782.5559369.p0 Protein 8e-43 44
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR NC_002951.3237708.p0 Protein 8e-43 44
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR NC_003923.1003749.p0 Protein 7e-43 44
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR NC_002758.1121668.p0 Protein 8e-43 44
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR NC_009641.5332272.p0 Protein 8e-43 44
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR NC_013450.8614421.p0 Protein 8e-43 44
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR HE999704.1.gene2815. Protein 3e-41 43
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR NC_012469.1.7686381. Protein 3e-40 42
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR NC_012469.1.7685629. Protein 2e-39 41
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR BAC0125 Protein 1e-33 41
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR FJ349556.1.orf0.gene Protein 1e-38 41
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR AE016830.1.gene1681. Protein 6e-39 41
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR CP004022.1.gene3215. Protein 2e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR VFG1702 Protein 1e-36 43
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR VFG1386 Protein 2e-36 43
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR VFG1563 Protein 6e-36 42
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR VFG1390 Protein 8e-39 41
phoB YP_005029938.1 response regulator in two-component regulatory system with PhoR VFG1389 Protein 2e-32 41