Gene Information

Name : Dsui_2499 (Dsui_2499)
Accession : YP_005028693.1
Strain : Dechlorosoma suillum PS
Genome accession: NC_016616
Putative virulence/resistance : Resistance
Product : MerE protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2647150 - 2647386 bp
Length : 237 bp
Strand : +
Note : PFAM: MerE protein

DNA sequence :
ATGAACAGCCCCGAGCGCTTGCCGTCCGAGACGCACAAACCGATCACCGGCTACCTGTGGGGCGCGCTGGCCGTGCTCAC
CTGTCCCTGCCATTTGCCGATTCTCGCCATTGTGCTGGCCGGCACGACGGCCGGCGCGTTCATCGGAGAGTACTGGGGTA
TCGCAGCCCTCACGCTGACCGGTTTGTTCGTCCTGTCTGTGACACGACTGCTGCGGGCCTTCAAAGATCGATCATGA

Protein sequence :
MNSPERLPSETHKPITGYLWGALAVLTCPCHLPILAIVLAGTTAGAFIGEYWGIAALTLTGLFVLSVTRLLRAFKDRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merE CAJ77058.1 Hypothetical protein Not tested AbaR1 Protein 7e-30 97
merE ACN81003.1 MerE Not tested AbaR5 Protein 9e-30 97
merE AGK07019.1 MerE Not tested SGI1 Protein 3e-27 83
merE AGK07077.1 MerE Not tested SGI1 Protein 3e-27 83
merE ABQ57369.1 MerE Not tested SGI1 Protein 3e-27 83
merE YP_006098385.1 putative mercury resistance protein Not tested Tn2411 Protein 2e-26 79
merE ACF06180.1 mercuric resistance protein Not tested Tn5036-like Protein 1e-26 79
merE AET25395.1 MerE Not tested PAGI-2(C) Protein 1e-26 79
merE AFG30118.1 MerE Not tested PAGI-2 Protein 1e-26 79

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dsui_2499 YP_005028693.1 MerE protein BAC0672 Protein 8e-32 100
Dsui_2499 YP_005028693.1 MerE protein BAC0670 Protein 2e-29 90
Dsui_2499 YP_005028693.1 MerE protein BAC0671 Protein 1e-27 83
Dsui_2499 YP_005028693.1 MerE protein BAC0673 Protein 1e-27 83