Gene Information

Name : Dsui_2498 (Dsui_2498)
Accession : YP_005028692.1
Strain : Dechlorosoma suillum PS
Genome accession: NC_016616
Putative virulence/resistance : Resistance
Product : mercuric resistance transcriptional repressor protein MerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2646788 - 2647153 bp
Length : 366 bp
Strand : +
Note : TIGRFAM: mercuric resistence transcriptional repressor protein MerD

DNA sequence :
ATGAGCGCCTACACCGTGTCCCGGCTGGCCCTTGATGCCGGGGTGAGCGTGCATATCGTGCGCGACTACCTGCTGCGCGG
ATTGCTGCGTCCGGTGGCGTGCACCCCGGGCGGCTATGGCCTGTTCGATGATGCCGCCTTGCAACGGCTGTGCTTCGTGC
GGGCGGCCTTCGAGGCGGGCATCGGCCTGGACGCGCTGGCGCGGCTGTGCCGGGCGCTGGATGCTGCGGACGGCGATGAA
GCGGCCGCGCAGCTTGCCGTTCTGCGCCAGTTCGTCGAGCGTCGGCGCGAAGCGTTGGCCGATCTGGAGGTGCAGTTGGC
CACCATGCCGACCGAGCCGGCACAGCACGCGGAGAGTCTGCCATGA

Protein sequence :
MSAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTPGGYGLFDDAALQRLCFVRAAFEAGIGLDALARLCRALDAADGDE
AAAQLAVLRQFVERRREALADLEVQLATMPTEPAQHAESLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merD AGK07020.1 MerD Not tested SGI1 Protein 2e-35 98
merD AGK07078.1 MerD Not tested SGI1 Protein 2e-35 98
merD ABQ57370.1 MerD Not tested SGI1 Protein 4e-35 97
merD ACN81004.1 MerD Not tested AbaR5 Protein 2e-32 92
merD CAJ77059.1 Mercury operon coregulator protein Not tested AbaR1 Protein 3e-32 92
merD ACF06181.1 mercuric resistance protein Not tested Tn5036-like Protein 6e-29 85
merD AET25396.1 MerD Not tested PAGI-2(C) Protein 6e-29 85
merD AFG30119.1 MerD Not tested PAGI-2 Protein 6e-29 85
merD YP_006098386.1 MerR family transcriptional regulator Not tested Tn2411 Protein 8e-29 85

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dsui_2498 YP_005028692.1 mercuric resistance transcriptional repressor protein MerD BAC0666 Protein 6e-36 99
Dsui_2498 YP_005028692.1 mercuric resistance transcriptional repressor protein MerD BAC0668 Protein 7e-36 98
Dsui_2498 YP_005028692.1 mercuric resistance transcriptional repressor protein MerD BAC0665 Protein 1e-36 98
Dsui_2498 YP_005028692.1 mercuric resistance transcriptional repressor protein MerD BAC0227 Protein 2e-35 97
Dsui_2498 YP_005028692.1 mercuric resistance transcriptional repressor protein MerD BAC0667 Protein 4e-36 93
Dsui_2498 YP_005028692.1 mercuric resistance transcriptional repressor protein MerD BAC0669 Protein 5e-35 87