Gene Information

Name : Dsui_2495 (Dsui_2495)
Accession : YP_005028689.1
Strain : Dechlorosoma suillum PS
Genome accession: NC_016616
Putative virulence/resistance : Resistance
Product : mercuric transport periplasmic protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2644605 - 2644880 bp
Length : 276 bp
Strand : +
Note : PFAM: Heavy-metal-associated domain; TIGRFAM: copper ion binding protein; mercuric transport protein periplasmic component

DNA sequence :
ATGAAAAAGCTGCTTTCCGCCCTTGCCCTCGCTGCCGTTGTTGCCCCCGTGTGGGCCGCCACCCAGACCGTTACGCTGTC
CGTACCGGGCATGACCTGCTCGGCCTGTCCGATCACTGTCAAGAAGGCGATTTCCAAGGTCGATGGCGTCAGTAAAGTTG
ACGTGACCTTCGAGACGCGCGAAGCGGTGGTCACCTTCGATGATGCCAAGACCAGCGTGCAGAAACTGACCAAGGCTACC
GAGGATGCGGGCTACCCATCATCAGTCAAGAACTGA

Protein sequence :
MKKLLSALALAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAISKVDGVSKVDVTFETREAVVTFDDAKTSVQKLTKAT
EDAGYPSSVKN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ABQ57373.1 MerP Not tested SGI1 Protein 5e-22 85
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 5e-22 85
merP AFG30122.1 MerP Not tested PAGI-2 Protein 5e-22 85
merP AGK07023.1 MerP Not tested SGI1 Protein 5e-22 85
merP AGK07081.1 MerP Not tested SGI1 Protein 5e-22 85
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 7e-22 85
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-21 82
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-21 82
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 2e-21 79

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dsui_2495 YP_005028689.1 mercuric transport periplasmic protein BAC0231 Protein 5e-24 96
Dsui_2495 YP_005028689.1 mercuric transport periplasmic protein BAC0679 Protein 1e-23 96
Dsui_2495 YP_005028689.1 mercuric transport periplasmic protein BAC0678 Protein 1e-23 94
Dsui_2495 YP_005028689.1 mercuric transport periplasmic protein BAC0675 Protein 5e-19 72
Dsui_2495 YP_005028689.1 mercuric transport periplasmic protein BAC0674 Protein 4e-15 60