Gene Information

Name : Dsui_2493 (Dsui_2493)
Accession : YP_005028687.1
Strain : Dechlorosoma suillum PS
Genome accession: NC_016616
Putative virulence/resistance : Resistance
Product : Hg(II)-responsive transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2643733 - 2644167 bp
Length : 435 bp
Strand : -
Note : PFAM: MerR family regulatory protein; MerR, DNA binding; TIGRFAM: Hg(II)-responsive transcriptional regulator

DNA sequence :
ATGGAAAACAATTTGGAGAACCTGACCATTGGCGTTTTCGCCAGGACGGCCGGGGTCAATGTGGAGACCATCCGGTTCTA
TCAGCGCAAGGGCTTGCTCCCGGAACCGGACAAGCCTTACGGCAGCATTCGCCGCTATGGCGAGACGGATGTAACGCGGG
TGCGCTTCGTGAAATCAGCCCAGCGGTTGGGCTTCAGCCTGGATGAGATCGCCGAGCTGCTGCGGCTGGAGGATGGCACC
CATTGCGAGGAAGCCAGCAGCCTGGCCGAGCACAAGCTCAAGGACGTGCGCGAGAGGATGGCTGACCTGGCGCGCATGGA
GGCCGTGCTGTCTGATTTGGTGTGCGCCTGCCATGCGCGGAAGGGGAACGTTTCCTGCCCGCTGATTGCGTCACTGCAAG
GGAAGAAAGAACCGCGCAGTGCGGACGCGGTGTAG

Protein sequence :
MENNLENLTIGVFARTAGVNVETIRFYQRKGLLPEPDKPYGSIRRYGETDVTRVRFVKSAQRLGFSLDEIAELLRLEDGT
HCEEASSLAEHKLKDVRERMADLARMEAVLSDLVCACHARKGNVSCPLIASLQGKKEPRSADAV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACK44535.1 MerR Not tested SGI1 Protein 3e-57 93
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 3e-57 93
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 5e-57 93
merR AFG30124.1 MerR Not tested PAGI-2 Protein 3e-57 93
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 4e-57 93
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 3e-57 93
merR AGK07025.1 MerR Not tested SGI1 Protein 2e-56 92
merR AGK07083.1 MerR Not tested SGI1 Protein 2e-56 92
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-48 75
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 8e-46 73
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 3e-27 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dsui_2493 YP_005028687.1 Hg(II)-responsive transcriptional regulator BAC0688 Protein 1e-62 95
Dsui_2493 YP_005028687.1 Hg(II)-responsive transcriptional regulator BAC0232 Protein 8e-58 95
Dsui_2493 YP_005028687.1 Hg(II)-responsive transcriptional regulator BAC0687 Protein 8e-58 95
Dsui_2493 YP_005028687.1 Hg(II)-responsive transcriptional regulator BAC0684 Protein 4e-58 94
Dsui_2493 YP_005028687.1 Hg(II)-responsive transcriptional regulator BAC0683 Protein 6e-58 93
Dsui_2493 YP_005028687.1 Hg(II)-responsive transcriptional regulator BAC0689 Protein 3e-55 92
Dsui_2493 YP_005028687.1 Hg(II)-responsive transcriptional regulator BAC0686 Protein 8e-60 91