Gene Information

Name : VEJY3_22691 (VEJY3_22691)
Accession : YP_005025922.1
Strain :
Genome accession: NC_016614
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1554841 - 1555152 bp
Length : 312 bp
Strand : -
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGACAAAACGACAACGACGTACATTTTCTGCTGAATTCAAAATGGATGCTGCAAGTTTGGTTCTTGACCAAGGATATTC
AGTACCTGAAGCAGCACGCTCCATGAATGTGGGTGAAACAGCTTTACGACGGTGGGTCGACCAACTCAAGATTGAGCGTG
GTGGTACAACTCCGACGGCCAAGGCCCTTACGCCTGAACAACAAAAAATCCAGGAATTAGAAGCCAGAATTAGTCGGTTA
GAAAGAGAGAAAGCCATACTAAAAAAGGCCACCGCTCTCTTAATGTCGGACGAACTCGAACGTTCTCGTTAA

Protein sequence :
MTKRQRRTFSAEFKMDAASLVLDQGYSVPEAARSMNVGETALRRWVDQLKIERGGTTPTAKALTPEQQKIQELEARISRL
EREKAILKKATALLMSDELERSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-32 77
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-26 62
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-26 62
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-26 62
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-26 62
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 9e-26 62
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-26 62
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 9e-26 62
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-26 62
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 5e-23 58
l7045 CAD33744.1 - Not tested PAI I 536 Protein 3e-23 56
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 3e-23 56
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 6e-23 56
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 9e-25 55
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 6e-25 55
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-23 53
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 3e-23 53
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 3e-23 53
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-23 53
api80 CAF28554.1 putative transposase Not tested YAPI Protein 9e-19 52
ORF SG13 AAN62235.1 conserved hypothetical protein Not tested PAGI-3(SG) Protein 1e-15 46
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 3e-13 44
tnpA CAB61575.1 transposase A Not tested HPI Protein 2e-17 43
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 8e-18 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VEJY3_22691 YP_005025922.1 transposase IS3/IS911 family protein VFG1123 Protein 2e-26 62
VEJY3_22691 YP_005025922.1 transposase IS3/IS911 family protein VFG1553 Protein 2e-23 58
VEJY3_22691 YP_005025922.1 transposase IS3/IS911 family protein VFG1485 Protein 1e-23 56
VEJY3_22691 YP_005025922.1 transposase IS3/IS911 family protein VFG0784 Protein 7e-24 53
VEJY3_22691 YP_005025922.1 transposase IS3/IS911 family protein VFG1566 Protein 1e-13 44