Gene Information

Name : KOX_02125 (KOX_02125)
Accession : YP_005016405.1
Strain : Klebsiella oxytoca KCTC 1686
Genome accession: NC_016612
Putative virulence/resistance : Virulence
Product : toxin of the YpjF-YfjZ toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 454889 - 455212 bp
Length : 324 bp
Strand : -
Note : -

DNA sequence :
ATGAAATTTCTACCTGCAACAAATATGCGGGCGGCGAAGCCATGCCTGTCGCCCGTGACTATCTGGCAAATGCTACTTAG
TCGTCTGCTGGAACAGCATTATGGCCTGACACTAAACGATACACCTTTCTGTGATGAAACCGTCATACAGGAACATATCG
ATGCCGGTATCACTCTCGCTAATGCCATTAACTTTCTAGTGGAAAAGTACGAACTGGTTCGTATCGATCGCAGAGGGTTT
AGCTGGCAAGAACAAACGCCATATCTCACGATTATTGATATCATGAGGGCCCGTCGCGATCTGGGTTTAATGAATCGTAA
TTAG

Protein sequence :
MKFLPATNMRAAKPCLSPVTIWQMLLSRLLEQHYGLTLNDTPFCDETVIQEHIDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTIIDIMRARRDLGLMNRN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 4e-30 65
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 4e-30 65
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 1e-30 64
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 1e-29 64
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 1e-30 64
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 9e-31 64
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-29 64
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 2e-29 64
unnamed AAC31486.1 L0007 Not tested LEE Protein 1e-29 63
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 1e-29 63
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 7e-29 63
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 1e-29 63
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 1e-29 63
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 7e-30 63
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 5e-30 63
unnamed AAL57575.1 unknown Not tested LEE Protein 2e-30 63
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 1e-29 63
unnamed AAL08478.1 unknown Not tested SRL Protein 1e-28 62
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 2e-30 62
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 1e-30 62
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 2e-30 62
YE3459 YP_001007621.1 hypothetical protein Not tested YAPI Protein 7e-11 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KOX_02125 YP_005016405.1 toxin of the YpjF-YfjZ toxin-antitoxin system VFG1682 Protein 6e-31 64
KOX_02125 YP_005016405.1 toxin of the YpjF-YfjZ toxin-antitoxin system VFG1530 Protein 3e-29 63
KOX_02125 YP_005016405.1 toxin of the YpjF-YfjZ toxin-antitoxin system VFG0786 Protein 4e-30 63
KOX_02125 YP_005016405.1 toxin of the YpjF-YfjZ toxin-antitoxin system VFG1620 Protein 2e-30 63
KOX_02125 YP_005016405.1 toxin of the YpjF-YfjZ toxin-antitoxin system VFG1069 Protein 4e-29 62
KOX_02125 YP_005016405.1 toxin of the YpjF-YfjZ toxin-antitoxin system VFG0663 Protein 5e-31 62