Gene Information

Name : PECL_433 (PECL_433)
Accession : YP_005004412.1
Strain : Pediococcus claussenii ATCC BAA-344
Genome accession: NC_016605
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 432597 - 433289 bp
Length : 693 bp
Strand : +
Note : -

DNA sequence :
ATGACGAAGACGATACTATTAGTTGAAGATGAGAAAGCATTAGCTGATTCTTTGAGGGAAGAATTTCAATTTGAAGACTA
TCAAGTGTTAACCACATTTGATGGTATATCTGCGGTAGATTGTTTCAAAAATAATCAAGCTCAAATTGACTTGATTATTT
TAGATTGGATGCTACCTGAGCTTGACGGACTTGGTGTACTCAGAAGAATAAGGCGAGAAAGCGACGTACCAATTATCATG
TTAACTGCGAGAGACTATGTGGGTGATAAAGTAGCTGGGTTAACTGGTGGTGCGGATGATTATATTACTAAACCGTTTGA
TATCGAAGAACTGTTAGCCAGAATGGACGTGGTTTTGAGGAGATCACGTAAATTTCAGGATTCTGAGCGGAATGATTTAT
TAGTTTTAGACAATTTGAGGGTTGATGTGAAAAATCAGCAGGTAACTAGAAATGAAAAAGATATTCAACTAACACAACGT
GAATTTCATTTACTCACGGAGTTATTAAAACAATCTGGTAAAATCCTTTCTAGGGACGAATTATTGGATGCGGTTTGGGG
AATTGACTTTACTGGACAACCTAATGTTGTTGATGTTTACATTCGTTATCTAAGAAATAAAATAGATCGTATTCCTGGAG
AAAATGCGTTGATTCACACCGTTCGAGGTAGAGGCTATAAAATTTCAAAGTGA

Protein sequence :
MTKTILLVEDEKALADSLREEFQFEDYQVLTTFDGISAVDCFKNNQAQIDLIILDWMLPELDGLGVLRRIRRESDVPIIM
LTARDYVGDKVAGLTGGADDYITKPFDIEELLARMDVVLRRSRKFQDSERNDLLVLDNLRVDVKNQQVTRNEKDIQLTQR
EFHLLTELLKQSGKILSRDELLDAVWGIDFTGQPNVVDVYIRYLRNKIDRIPGENALIHTVRGRGYKISK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-30 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-29 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PECL_433 YP_005004412.1 two-component response regulator HE999704.1.gene1528. Protein 5e-34 49
PECL_433 YP_005004412.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-33 46
PECL_433 YP_005004412.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-33 46
PECL_433 YP_005004412.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-33 46
PECL_433 YP_005004412.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-33 46
PECL_433 YP_005004412.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-33 46
PECL_433 YP_005004412.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-33 46
PECL_433 YP_005004412.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-33 46
PECL_433 YP_005004412.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-33 46
PECL_433 YP_005004412.1 two-component response regulator AE015929.1.gene1106. Protein 4e-28 45
PECL_433 YP_005004412.1 two-component response regulator NC_012469.1.7685629. Protein 6e-38 43
PECL_433 YP_005004412.1 two-component response regulator BAC0197 Protein 2e-28 43
PECL_433 YP_005004412.1 two-component response regulator BAC0308 Protein 4e-27 42
PECL_433 YP_005004412.1 two-component response regulator BAC0125 Protein 3e-28 42
PECL_433 YP_005004412.1 two-component response regulator AE016830.1.gene1681. Protein 2e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PECL_433 YP_005004412.1 two-component response regulator VFG0596 Protein 3e-30 44
PECL_433 YP_005004412.1 two-component response regulator VFG1390 Protein 9e-40 44
PECL_433 YP_005004412.1 two-component response regulator VFG1386 Protein 1e-36 43
PECL_433 YP_005004412.1 two-component response regulator VFG1389 Protein 2e-32 42