Gene Information

Name : vicR (PECL_1831)
Accession : YP_005005719.1
Strain : Pediococcus claussenii ATCC BAA-344
Genome accession: NC_016605
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1787339 - 1788037 bp
Length : 699 bp
Strand : -
Note : -

DNA sequence :
ATGCCAAAGATTTTAGTAGTAGATGATGAAAAACCTATTTCAGATATTGTTAAATTTAATTTAACCAAAGAAGGTTATGA
TGTTGTGACCGCTTACGATGGTGAAGAAGCGCTCGCTTTAGTTGAAAGTGAAAAACCAGATTTGATTTTATTAGATTTAA
TGTTACCTAAAATAGATGGGCTTGAGGTTGCTCGTCAGGTTCGAGCAAAACATAACATTCCAATCATTATGGTAACGGCA
AAGGATTCAGAATTAGATAAAGTTGTTGGACTGGAACTCGGTGCCGATGATTACGTTACTAAACCATTTTCAAATCGTGA
ACTGGTTGCTCGAGTAAAGGCCAATTTACGTCGCCAAGACCAACTGCAAACTGAGCAAACTGAAAATAACAATTTGAAAA
TTGGCCCATTATTAATCAACGCCGATTCGTATTCTGTTACGCGGGATGGCAACCAATTAGATTTAACGCATCGTGAGTTT
GAGTTATTGCATTATTTGGCAAAACATATTGGTCAAGTAATGACACGAGAGCATCTACTTCAGACTGTGTGGGGATATGA
TTATTTTGGTGATGTTCGTACAGTCGATGTTACGGTTCGAAGATTACGTGAAAAAATTGAAGAGACACCAGGTAATCCCC
AAATCTTGGTCACACGACGTGGAGTTGGTTATTACCTAAGAAACCCTGATAATGCTTAA

Protein sequence :
MPKILVVDDEKPISDIVKFNLTKEGYDVVTAYDGEEALALVESEKPDLILLDLMLPKIDGLEVARQVRAKHNIPIIMVTA
KDSELDKVVGLELGADDYVTKPFSNRELVARVKANLRRQDQLQTEQTENNNLKIGPLLINADSYSVTRDGNQLDLTHREF
ELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEETPGNPQILVTRRGVGYYLRNPDNA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-30 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-35 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-35 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-30 42
kdeP YP_190033.1 DNA-binding response regulator KdeP Not tested Type-II SCCmec Protein 4e-25 41
SH0031 YP_251946.1 hypothetical protein Not tested SCCmec Protein 1e-25 41
kdpE BAA82188.1 KDP operon transcriptional regulatory protein KdpE Not tested Type-II SCCmec Protein 3e-25 41
kdpE YP_039536.1 response regulator protein Not tested Type-II SCCmec Protein 4e-25 41
kdpE NP_370594.1 transcriptional regulator kdpE Not tested Type-II SCCmec Protein 4e-25 41
kdpE NP_373306.1 hypothetical protein Not tested Type-II SCCmec Protein 4e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
vicR YP_005005719.1 response regulator NC_012469.1.7685629. Protein 2e-68 68
vicR YP_005005719.1 response regulator HE999704.1.gene2815. Protein 4e-48 55
vicR YP_005005719.1 response regulator NC_009782.5559369.p0 Protein 1e-53 53
vicR YP_005005719.1 response regulator NC_002951.3237708.p0 Protein 1e-53 53
vicR YP_005005719.1 response regulator NC_003923.1003749.p0 Protein 1e-53 53
vicR YP_005005719.1 response regulator NC_002758.1121668.p0 Protein 1e-53 53
vicR YP_005005719.1 response regulator NC_009641.5332272.p0 Protein 1e-53 53
vicR YP_005005719.1 response regulator NC_013450.8614421.p0 Protein 1e-53 53
vicR YP_005005719.1 response regulator NC_007793.3914279.p0 Protein 1e-53 53
vicR YP_005005719.1 response regulator NC_002745.1124361.p0 Protein 1e-53 53
vicR YP_005005719.1 response regulator NC_002952.2859905.p0 Protein 3e-53 52
vicR YP_005005719.1 response regulator NC_007622.3794472.p0 Protein 2e-53 52
vicR YP_005005719.1 response regulator NC_012469.1.7686381. Protein 3e-43 49
vicR YP_005005719.1 response regulator BAC0533 Protein 2e-33 48
vicR YP_005005719.1 response regulator CP000647.1.gene4257. Protein 2e-33 48
vicR YP_005005719.1 response regulator CP001918.1.gene5135. Protein 7e-29 48
vicR YP_005005719.1 response regulator AE016830.1.gene1681. Protein 6e-43 47
vicR YP_005005719.1 response regulator NC_002695.1.915041.p Protein 8e-34 47
vicR YP_005005719.1 response regulator CP001138.1.gene4273. Protein 4e-33 47
vicR YP_005005719.1 response regulator CP004022.1.gene3215. Protein 1e-36 47
vicR YP_005005719.1 response regulator CP000034.1.gene3834. Protein 8e-34 47
vicR YP_005005719.1 response regulator AF155139.2.orf0.gene Protein 3e-40 46
vicR YP_005005719.1 response regulator FJ349556.1.orf0.gene Protein 7e-41 46
vicR YP_005005719.1 response regulator AE000516.2.gene3505. Protein 4e-36 46
vicR YP_005005719.1 response regulator AF162694.1.orf4.gene Protein 9e-37 45
vicR YP_005005719.1 response regulator AE015929.1.gene1106. Protein 2e-34 45
vicR YP_005005719.1 response regulator NC_002695.1.916589.p Protein 3e-33 45
vicR YP_005005719.1 response regulator CP001138.1.gene2239. Protein 7e-33 45
vicR YP_005005719.1 response regulator BAC0039 Protein 3e-33 45
vicR YP_005005719.1 response regulator BAC0596 Protein 7e-33 45
vicR YP_005005719.1 response regulator CP000034.1.gene2186. Protein 3e-33 45
vicR YP_005005719.1 response regulator AM180355.1.gene1830. Protein 3e-39 44
vicR YP_005005719.1 response regulator HE999704.1.gene1528. Protein 9e-32 43
vicR YP_005005719.1 response regulator AF130997.1.orf0.gene Protein 1e-35 43
vicR YP_005005719.1 response regulator DQ212986.1.gene4.p01 Protein 2e-38 43
vicR YP_005005719.1 response regulator NC_002951.3238224.p0 Protein 2e-38 43
vicR YP_005005719.1 response regulator NC_007793.3914065.p0 Protein 2e-38 43
vicR YP_005005719.1 response regulator NC_002758.1121390.p0 Protein 2e-38 43
vicR YP_005005719.1 response regulator NC_010079.5776364.p0 Protein 2e-38 43
vicR YP_005005719.1 response regulator NC_002952.2859858.p0 Protein 2e-38 43
vicR YP_005005719.1 response regulator NC_007622.3794948.p0 Protein 2e-38 43
vicR YP_005005719.1 response regulator NC_003923.1003417.p0 Protein 2e-38 43
vicR YP_005005719.1 response regulator NC_013450.8614146.p0 Protein 2e-38 43
vicR YP_005005719.1 response regulator CP001918.1.gene3444. Protein 8e-32 43
vicR YP_005005719.1 response regulator NC_005054.2598277.p0 Protein 2e-39 42
vicR YP_005005719.1 response regulator NC_014475.1.orf0.gen Protein 2e-39 42
vicR YP_005005719.1 response regulator NC_010410.6002989.p0 Protein 6e-31 42
vicR YP_005005719.1 response regulator NC_010400.5986590.p0 Protein 2e-30 42
vicR YP_005005719.1 response regulator NC_011595.7057856.p0 Protein 6e-31 42
vicR YP_005005719.1 response regulator CP000647.1.gene2531. Protein 2e-31 42
vicR YP_005005719.1 response regulator CP004022.1.gene1676. Protein 1e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
vicR YP_005005719.1 response regulator VFG1389 Protein 6e-33 44
vicR YP_005005719.1 response regulator VFG0596 Protein 1e-30 42
vicR YP_005005719.1 response regulator VFG1563 Protein 8e-36 42
vicR YP_005005719.1 response regulator VFG1702 Protein 2e-35 42