Gene Information

Name : MycrhN_4371 (MycrhN_4371)
Accession : YP_005002085.1
Strain : Mycobacterium rhodesiae NBB3
Genome accession: NC_016604
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4391223 - 4391906 bp
Length : 684 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGGATGAACCTGTGCGAGTGCTGGTGGTCGAAGACGAGGTTCGCCTCGCCGAGACGATCCGGCGAGGCCTGGAATCAGA
GGGCTTCGTCGTCGACGTCGAGCATCGCGGCGACGACGGATTTCACACCGCCGTGTCGGGAACATTCGACGCGATCATTC
TGGACATCATGTTGCCCGGCAAGAACGGCTACGACTTCGTGCGCGATCTGCGCGATCAGAATGTCTGGACTCCGGTGTTG
ATGTTGTCGGCGAAGGACGGTGAATACGACCTGGCCGATGCGTTTGATTTGGGCGCAGACGACTACCTGGTCAAACCGTT
CTCCTTCGTCGTCCTGTTCGCCAGACTTCGAGCTCTGATTCGGCGTGGGGCGCCCGAACGTCCCCCGGTGTTGACTGCCG
GTGATGTCGAGCTCGACCCGGCGCGACACAAGGTGAGTCGCGCGGGAATCGAGCTGTCCTTGACGCCAAGGGAATACTCC
GTCCTGGAGTTTCTCATGCGACATCGCGATCGGGTGGTCAGCAAGACTGAAATCGTCAACGCCGTGTGGGACAACCATTA
CGGCGGCGACGAAAACATCGTCGAGGTCTACATCCGGTATCTGCGCCGGAAGATCGACTTACCGTTTTCCGGGCAGAGCA
TCGAAACCGTTCGCGGTGTCGGCTACCGATTCGTCGGCAGTTGA

Protein sequence :
MDEPVRVLVVEDEVRLAETIRRGLESEGFVVDVEHRGDDGFHTAVSGTFDAIILDIMLPGKNGYDFVRDLRDQNVWTPVL
MLSAKDGEYDLADAFDLGADDYLVKPFSFVVLFARLRALIRRGAPERPPVLTAGDVELDPARHKVSRAGIELSLTPREYS
VLEFLMRHRDRVVSKTEIVNAVWDNHYGGDENIVEVYIRYLRRKIDLPFSGQSIETVRGVGYRFVGS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-30 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0111 Protein 3e-34 44
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 2e-32 44
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 1e-25 43
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0197 Protein 4e-32 43
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0347 Protein 7e-29 42
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 1e-28 42
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 1e-28 42
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 1e-28 42
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 1e-28 42
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 1e-28 42
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 1e-28 42
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 1e-28 42
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 1e-28 42
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0083 Protein 4e-31 42
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0308 Protein 2e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MycrhN_4371 YP_005002085.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0596 Protein 3e-30 42