Gene Information

Name : MycrhN_3414 (MycrhN_3414)
Accession : YP_005001152.1
Strain : Mycobacterium rhodesiae NBB3
Genome accession: NC_016604
Putative virulence/resistance : Resistance
Product : glutaredoxin-dependent arsenate reductase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3412925 - 3413269 bp
Length : 345 bp
Strand : -
Note : PFAM: ArsC family; TIGRFAM: arsenate reductase (glutaredoxin)

DNA sequence :

GTGCCGGACGCGCGGATTTACCACAACCCGAAGTGCTCGACCTCCCGTAAGACCCTGGAGTTGTTGCGGGACAACGGCAT
CGAGCCGACGGTCGTTCAGTACCTGAAGACGCCTCCGACGCGTGCCGAGATCGTGAAGATGATCAAGGATGCGGGTATCG
ACGTGCGCACTGCGGTGCGCAAACGCGAATCGCTCTACGGCGAACTGAAACTCGCCGACGCCAGCGACGACGAGCTGCTG
GATGCGATGGCTGAGCATCCGATTCTGATCGAGCGTCCGTTCGTCGTCACGCCGAAGGGCACCCGGCTGGCCCGCCCGAT
CGACGCGGTGCAAGAGATTCTGTGA

Protein sequence :

MPDARIYHNPKCSTSRKTLELLRDNGIEPTVVQYLKTPPTRAEIVKMIKDAGIDVRTAVRKRESLYGELKLADASDDELL
DAMAEHPILIERPFVVTPKGTRLARPIDAVQEIL

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
arsC2	YP_001007634.1	arsenate reductase	Not tested	YAPI	Protein	4e-21	54
arsC	ADZ05768.1	arsenate reductase	Not tested	AbaR11	Protein	1e-21	50

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
MycrhN_3414	YP_005001152.1	glutaredoxin-dependent arsenate reductase	BAC0583	Protein	3e-22	57
MycrhN_3414	YP_005001152.1	glutaredoxin-dependent arsenate reductase	BAC0584	Protein	4e-22	56
MycrhN_3414	YP_005001152.1	glutaredoxin-dependent arsenate reductase	BAC0582	Protein	8e-22	55
MycrhN_3414	YP_005001152.1	glutaredoxin-dependent arsenate reductase	BAC0585	Protein	2e-21	55