Gene Information

Name : BYI23_E002770 (BYI23_E002770)
Accession : YP_004980225.1
Strain :
Genome accession: NC_016591
Putative virulence/resistance : Resistance
Product : putative heavy metal transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 235862 - 236275 bp
Length : 414 bp
Strand : +
Note : -

DNA sequence :
ATGAGCGATCACGTTTTCGGGAAGGGAATGCAGCGCGCTGACTTGGCCAAGCTTACGGGCTGCAATCTGGAAACCATCCG
CTATTACGAGAAAATCGGTATGATGCCGGACCCGCCGCGCACGGCCTCCGGCTACCGCATTTATGGCGAGGACCACGTAT
CCCGCCTGCGCTTCATCTTGCGCGGCCGCGAACTCGGCTTTTCGCTCGACGAAGTACGCGGCCTGCTTGCCCTCGTCGAG
GGCGGCGCGCAGACCTGCGCAGAGGTCAAGGAGCGCACTGAGCGGCATCTGGCCGATGTGCGCGCGAAGATCGCCGATCT
CAGGCGCATCGAGAAAGTGCTGACCCAGACCGCCGCGCAATGCTCCGGCGATATGGTGCCGGACTGCCCGATCATCGAGG
TGCTCGCCTCATGA

Protein sequence :
MSDHVFGKGMQRADLAKLTGCNLETIRYYEKIGMMPDPPRTASGYRIYGEDHVSRLRFILRGRELGFSLDEVRGLLALVE
GGAQTCAEVKERTERHLADVRAKIADLRRIEKVLTQTAAQCSGDMVPDCPIIEVLAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 1e-22 43
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 5e-20 42
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 3e-20 42
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 3e-18 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BYI23_E002770 YP_004980225.1 putative heavy metal transcriptional regulator BAC0682 Protein 3e-24 43
BYI23_E002770 YP_004980225.1 putative heavy metal transcriptional regulator BAC0689 Protein 1e-18 43
BYI23_E002770 YP_004980225.1 putative heavy metal transcriptional regulator BAC0569 Protein 2e-21 42
BYI23_E002770 YP_004980225.1 putative heavy metal transcriptional regulator BAC0190 Protein 1e-25 42
BYI23_E002770 YP_004980225.1 putative heavy metal transcriptional regulator BAC0688 Protein 8e-21 42
BYI23_E002770 YP_004980225.1 putative heavy metal transcriptional regulator BAC0301 Protein 5e-21 41
BYI23_E002770 YP_004980225.1 putative heavy metal transcriptional regulator BAC0686 Protein 1e-20 41
BYI23_E002770 YP_004980225.1 putative heavy metal transcriptional regulator BAC0687 Protein 3e-19 41
BYI23_E002770 YP_004980225.1 putative heavy metal transcriptional regulator BAC0684 Protein 4e-20 41
BYI23_E002770 YP_004980225.1 putative heavy metal transcriptional regulator BAC0232 Protein 3e-19 41
BYI23_E002770 YP_004980225.1 putative heavy metal transcriptional regulator BAC0683 Protein 7e-20 41