Gene Information

Name : BYI23_A004770 (BYI23_A004770)
Accession : YP_004976292.1
Strain :
Genome accession: NC_016589
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 536939 - 537601 bp
Length : 663 bp
Strand : +
Note : -

DNA sequence :
ATGCGAATCCTGCTTGTCGAAGATGACCGGATGATCGCCGAAGGCGTGCGCAAGGCCCTGCGCGCGGACGGCTTCGCAGT
CGACTGGGTGCAGGACGGCGAGGCCGCGCTCACCGCAGTGGCCGGCGAGTCCTACGACCTGATGCTGCTCGATCTCGGCC
TGCCCAAGCGCGACGGCCTCGACGTGCTGAAGACGCTGCGCGCGCGCGCCAATGCGCTGCCGGTGCTGATCGTCACGGCG
CGCGACGCCATCGCGGATCGCGTAAAAGGCCTCGACGCCGGCGCGGACGATTACCTCGTGAAGCCCTTCGATCTCGACGA
GCTCGGCGCGCGCATGCGTGCGCTGATCCGCCGTCACGCGGGGCGCGGCGAGTCGCTCGTGCGTCACGGCGAACTGACGC
TCGATCCCGTGGGCCATCAGGTGACGCTCGCGGGCAATCCCGTGGCGCTGTCGGCGCGCGAGTTCGCGCTGCTCGAAGCG
CTGATGGCGCGGCCCGGCGCGGTGCTGTCCAAGAGCCAGCTCGAAGAGAAGATCTACGGCTGGGGCGAGGAAATCGGCAG
CAATACCGTCGAGGTGTATATCCACTCGCTGAGAAAGAAGCTCGGCGCCGATCTCATCCGCAACGTGCGTGGCCTCGGCT
ACATGGTCGCGAAGGACGCCTGA

Protein sequence :
MRILLVEDDRMIAEGVRKALRADGFAVDWVQDGEAALTAVAGESYDLMLLDLGLPKRDGLDVLKTLRARANALPVLIVTA
RDAIADRVKGLDAGADDYLVKPFDLDELGARMRALIRRHAGRGESLVRHGELTLDPVGHQVTLAGNPVALSAREFALLEA
LMARPGAVLSKSQLEEKIYGWGEEIGSNTVEVYIHSLRKKLGADLIRNVRGLGYMVAKDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 5e-45 50
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-34 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BYI23_A004770 YP_004976292.1 winged helix family two component transcriptional regulator BAC0487 Protein 3e-44 46
BYI23_A004770 YP_004976292.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-41 45
BYI23_A004770 YP_004976292.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-33 43
BYI23_A004770 YP_004976292.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-38 42
BYI23_A004770 YP_004976292.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-31 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BYI23_A004770 YP_004976292.1 winged helix family two component transcriptional regulator VFG0473 Protein 3e-47 49
BYI23_A004770 YP_004976292.1 winged helix family two component transcriptional regulator VFG1390 Protein 9e-43 46
BYI23_A004770 YP_004976292.1 winged helix family two component transcriptional regulator VFG0596 Protein 4e-35 42
BYI23_A004770 YP_004976292.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-32 42