Gene Information

Name : AZOLI_p60134 (AZOLI_p60134)
Accession : YP_004975707.1
Strain :
Genome accession: NC_016588
Putative virulence/resistance : Unknown
Product : Tranposase of ISAli10, IS66 family. ORFB
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 154296 - 154643 bp
Length : 348 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type e : enzyme

DNA sequence : 
ATGATTCCGGTGCCGAGTGGCGTGCGGGTGTGGCTGGCCAGCGGGCACACCGACATGCGCAAGGGCTGGGCAAGCTTGGC
GCTGCTGGTGCAGGAACGCTTCGCCCAAGACCCGCACAGCGGTCATCTTTTCATTTTCCGCGGGCGCCGGGGCGATCTGG
TGAAGATCATCTGGTATGACGGCCAGGGCAGTTGCCTGTTCATGAAGAGGCTGGAGCGGGGCCGGTTCATCTGGCCGAGG
CCGGCGGACGGTGCGGTGTCCATCTCGGTTGGACAGATGGGCTATCTGCTCGAGGGCATCGACTGGCGCAACCCGCAGAA
GACCTGGCGCCCCGAGGCCGCGGGGTGA

Protein sequence : 
MIPVPSGVRVWLASGHTDMRKGWASLALLVQERFAQDPHSGHLFIFRGRRGDLVKIIWYDGQGSCLFMKRLERGRFIWPR
PADGAVSISVGQMGYLLEGIDWRNPQKTWRPEAAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-21 59
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 6e-29 57
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 5e-29 57
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-29 57
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 4e-27 57
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-27 57
unnamed AAL99258.1 unknown Not tested LEE Protein 4e-27 57
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-27 57
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 4e-27 57
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-27 57
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 5e-27 57
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 5e-27 57
unnamed AAC31493.1 L0014 Not tested LEE Protein 4e-27 57
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 5e-27 57
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 9e-27 56
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-27 56
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 9e-27 56
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-27 56
unnamed AAL08461.1 unknown Not tested SRL Protein 6e-27 56
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-26 56
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-26 56
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-27 54
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-26 52
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-26 52
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-24 51

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AZOLI_p60134 YP_004975707.1 Tranposase of ISAli10, IS66 family. ORFB VFG1517 Protein 9e-22 59
AZOLI_p60134 YP_004975707.1 Tranposase of ISAli10, IS66 family. ORFB VFG1665 Protein 2e-29 57
AZOLI_p60134 YP_004975707.1 Tranposase of ISAli10, IS66 family. ORFB VFG0792 Protein 1e-27 57
AZOLI_p60134 YP_004975707.1 Tranposase of ISAli10, IS66 family. ORFB VFG1698 Protein 1e-27 57
AZOLI_p60134 YP_004975707.1 Tranposase of ISAli10, IS66 family. ORFB VFG1709 Protein 1e-27 57
AZOLI_p60134 YP_004975707.1 Tranposase of ISAli10, IS66 family. ORFB VFG1052 Protein 2e-27 56
AZOLI_p60134 YP_004975707.1 Tranposase of ISAli10, IS66 family. ORFB VFG1737 Protein 6e-28 54