Gene Information

Name : AZOLI_p10173 (AZOLI_p10173)
Accession : YP_004973655.1
Strain :
Genome accession: NC_016585
Putative virulence/resistance : Unknown
Product : transposase of ISAli4, IS3 family subgroup IS51. ORFA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 182409 - 182738 bp
Length : 330 bp
Strand : +
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type e : enzyme

DNA sequence :
ATGACGAAACAGGCATCACCCAAATACGCCCCTGAAGTGCGCGAGCGCGCGGTTCGGATGGTGTTCGAGCACGAAGGCGA
GCATGCCTCGCAGTGGGCGGCGATCAGTTCGATCGCGGCGAAGATCGGCTGCACTCCGGAAACGCTGCGGGGCTGGGTCC
GGCAGGCCGAGCGTGACCAGGGCAAGCGGCCGGGGCCGACAACGGACGAGCAGGAACGGATCAAGGCTTTGGAGCGTGAG
GTGCGGGAGCTGCGCCAGGCGAATGAGATCCTACGCAAGGCGTCGGCGTATTTCGCCCAGGCGGAGCTCGACCGCCCGTT
CCGGAAATGA

Protein sequence :
MTKQASPKYAPEVRERAVRMVFEHEGEHASQWAAISSIAAKIGCTPETLRGWVRQAERDQGKRPGPTTDEQERIKALERE
VRELRQANEILRKASAYFAQAELDRPFRK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 6e-21 66
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 6e-21 66
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 6e-21 66
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 6e-21 66
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 3e-17 65
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-17 65
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 2e-20 64
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 2e-18 64
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 2e-20 64
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 2e-20 64
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 2e-20 64
unnamed AAF09023.1 unknown Not tested SHI-O Protein 9e-19 64
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 9e-19 64
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 2e-20 64
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 4e-19 63
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 4e-19 63
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 2e-18 63
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-18 63
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-18 63
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-18 63
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 3e-18 63
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 1e-16 63
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 3e-18 63
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 4e-19 63
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 2e-17 63
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-18 61
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 2e-18 61
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-18 61
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 2e-18 61
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 3e-18 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AZOLI_p10173 YP_004973655.1 transposase of ISAli4, IS3 family subgroup IS51. ORFA VFG1603 Protein 1e-18 64
AZOLI_p10173 YP_004973655.1 transposase of ISAli4, IS3 family subgroup IS51. ORFA VFG0643 Protein 9e-19 63
AZOLI_p10173 YP_004973655.1 transposase of ISAli4, IS3 family subgroup IS51. ORFA VFG0606 Protein 4e-18 63
AZOLI_p10173 YP_004973655.1 transposase of ISAli4, IS3 family subgroup IS51. ORFA VFG1717 Protein 9e-19 61