Gene Information

Name : Desor_1264 (Desor_1264)
Accession : YP_004969441.1
Strain : Desulfosporosinus orientis DSM 765
Genome accession: NC_016584
Putative virulence/resistance : Resistance
Product : stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1301804 - 1302385 bp
Length : 582 bp
Strand : +
Note : PFAM: Bacterial stress protein

DNA sequence :
GTGGGTATTAGCCTGCAAAAAGGACAAAAGATTGACTTAACCAAAGGGAACCCTGGTTTAACCAAGATTATCGTCGGATT
AGGCTGGGATACCAACAAATATTCTGGCGGATCAGATTTTGACTTAGATGCCTCAGTGTTCTTACTCGATAAAAACGGCA
GGGCCGGGGGGATTGAAGACTTTATTTATTACAATAACCTTGTCGGCGGCAATGGAGCGGTTACCCATACGGGAGATAAC
CTAACCGGAGCAGGCGATGGGGATGACGAACAAATTATCGTGGATTTAGCCCAGATACCTGCCCATGTTGAAAAGCTTGC
CTTTACCGTAACTATTCATGAAGCAGTACAAAGATCCCAGAACTTTGGACAAGTATCCAATTCCTTTGTTCGAGTTGTCA
ATGAAACCAACGGACAAGAAGTTTTGCGCTATGATTTAGGCGAAGATTTCTCCGTTGAGACAGCTTTGGTTGTCTGCGAG
TTATATCGTCACCAAGGAGAATGGAAGTTCAATGCCGTAGGCAGTGGTTTCTCTGGTGGATTAGCTGCTCTTTGCGGAAA
TTACGGGTTACAAGTTGACTAA

Protein sequence :
MGISLQKGQKIDLTKGNPGLTKIIVGLGWDTNKYSGGSDFDLDASVFLLDKNGRAGGIEDFIYYNNLVGGNGAVTHTGDN
LTGAGDGDDEQIIVDLAQIPAHVEKLAFTVTIHEAVQRSQNFGQVSNSFVRVVNETNGQEVLRYDLGEDFSVETALVVCE
LYRHQGEWKFNAVGSGFSGGLAALCGNYGLQVD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-57 62
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-53 56
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-53 56
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-53 55
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-45 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-45 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-45 54
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-47 52
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-25 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-25 42
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 9e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desor_1264 YP_004969441.1 stress response protein, TerZ- and CABP1 BAC0390 Protein 7e-50 57
Desor_1264 YP_004969441.1 stress response protein, TerZ- and CABP1 BAC0389 Protein 2e-52 55
Desor_1264 YP_004969441.1 stress response protein, TerZ- and CABP1 BAC0392 Protein 1e-25 42