Gene Information

Name : Desor_1263 (Desor_1263)
Accession : YP_004969440.1
Strain : Desulfosporosinus orientis DSM 765
Genome accession: NC_016584
Putative virulence/resistance : Resistance
Product : stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1301113 - 1301691 bp
Length : 579 bp
Strand : +
Note : PFAM: Bacterial stress protein

DNA sequence :
ATGGCAATTAGTTTACAAAAAGGTCAAAAAGTCGATCTTACCAAATCAAATCCGGGGCTTACTAAACTCATTGTTGGTCT
GGGTTGGGATGTCAACAAGTATGATGGCGGGAAAGATTTTGATTTAGACTCTTCAGTTTTCATGCTTAATTCTGAGGGGA
AAGTAACGGATGAAAAAAACTTTGTCTTCTTTAATAATCCCAAGAGTCCTGACGGATCAGTTATTCATACTGGGGATAAT
CGTACCGGAGCCGGTGAAGGGGATGACGAACAAATTAAAGTTGACCTGGCACTGGTTTCCAGCAATGTTTCCAAAATCAC
CTTCACAATAACCATTCATGAGGCTCAAGAACGCAATCAGAACTTTGGTCAAGTTTCTAACTCCTATGTTCGCGTTGTTA
ACGAAGCTTCAGGGGAAGAATTGATTCGCTACGATCTCGGTGAGGATTTCTCTATTGAGACGGCTATTGTTGTAGGAGAA
CTCTATCGCAATAATAATGAATGGAAGTTTAACGCCATCGGCAGCGGTTACCAAAACGGCTTAGCCGGTCTTTGCAGAGA
TTTTGGCCTAGACGTATAA

Protein sequence :
MAISLQKGQKVDLTKSNPGLTKLIVGLGWDVNKYDGGKDFDLDSSVFMLNSEGKVTDEKNFVFFNNPKSPDGSVIHTGDN
RTGAGEGDDEQIKVDLALVSSNVSKITFTITIHEAQERNQNFGQVSNSYVRVVNEASGEELIRYDLGEDFSIETAIVVGE
LYRNNNEWKFNAIGSGYQNGLAGLCRDFGLDV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-57 60
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-53 55
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-53 55
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-49 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-49 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-49 54
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 5e-53 54
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-49 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desor_1263 YP_004969440.1 stress response protein, TerZ- and CABP1 BAC0390 Protein 3e-52 55
Desor_1263 YP_004969440.1 stress response protein, TerZ- and CABP1 BAC0389 Protein 3e-53 54