Gene Information

Name : terD5 (SBI_07478)
Accession : YP_004965729.1
Strain : Streptomyces bingchenggensis BCW-1
Genome accession: NC_016582
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 8894601 - 8895176 bp
Length : 576 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGGCGTTACCCTCGCCAAGGGAGGCAATGTCTCCCTCACCAAGGCCGCGCCGAATCTCACCCAGGTGATGGTCGGCCT
GGGCTGGGACGCGCGCTCGACCACCGGGGCGCCGTTCGACCTCGACGCCAGCGCGCTGCTGTGCCAGTCGGGGCGGGTGC
TCGGGGACGAGTACTTCGTCTTCTACAACAACCTGAAGAGCCCCGAGGGCTCGGTCGAGCACACCGGCGACAACCTCACC
GGTGAGGGCGAGGGCGACGATGAGTCGATCCTGATCGATCTCAGCAAGGTCCCGGACCGGGTCGACAAGATCGTCTTCCC
CGTGTCGATCTATGACGCGGACACCAGGCGTCAGACGTTTGGGCAGGTCAGCAACGCATTCATCCGTGTGGTGAACCAGG
CGGACGGCGCCGAGCTGGCCCGCTACGACCTCTCGGAGGACGCCTCCAGCGAGACGGCGATGATCTTCGGGGAGGTTTAC
CGCTATGGCGGTGAGTGGAAGTTCCGGGCCGTAGGGCAGGGGTACGCGTCAGGTCTTCGGGGCATCGCTCTAGACTTCGG
GGTCAACGTTTCGTAA

Protein sequence :
MGVTLAKGGNVSLTKAAPNLTQVMVGLGWDARSTTGAPFDLDASALLCQSGRVLGDEYFVFYNNLKSPEGSVEHTGDNLT
GEGEGDDESILIDLSKVPDRVDKIVFPVSIYDADTRRQTFGQVSNAFIRVVNQADGAELARYDLSEDASSETAMIFGEVY
RYGGEWKFRAVGQGYASGLRGIALDFGVNVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-58 67
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-58 67
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-57 66
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-60 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-56 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-56 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-56 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-53 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD5 YP_004965729.1 tellurium resistance protein BAC0389 Protein 2e-57 66
terD5 YP_004965729.1 tellurium resistance protein BAC0390 Protein 3e-58 62