Gene Information

Name : terD2 (SBI_05592)
Accession : YP_004963843.1
Strain : Streptomyces bingchenggensis BCW-1
Genome accession: NC_016582
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 6833929 - 6834504 bp
Length : 576 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
GTGGGAGTTTCCCTGTCCAAAGGCGGCAACGTCTCGCTCAGCAAGGAGGCACCGGGCCTGACCGCGGTCCTGGTCGGCCT
CGGCTGGGACGTACGGACCACGACGGGCACCGACTACGACCTCGACGCCAGCGCCCTGCTCTGCGACGAAGCCGGGAAGG
TCCCCTCCAACCAGCACTTCGTCTTCTACAACAACCTCAAGAGCCCCGACGGCTCGGTCGAGCACACCGGCGACAACCTC
ACCGGCGAGGGCGACGGCGACGACGAATCCATCAAGGTCAACCTCGCCGCCGTGCCCGCCGAGATCACCAAGATCGTCTT
CCCGGTCTCCATCCACGACGCCGAATCCCGCGGCCAGAGCTTCGGCCAGGTCCGCAACGCCTTCATCCGTGTCGTCAACC
AGGCCGACGGCAATGAGCTCGCCCGCTACGACCTCAGCGAGGACGCCGCGACCGAGACCGCCATGGTCTTCGGCGAGCTC
TACCGGCACGGCGCGGAGTGGAAATTCCGCGCGGTCGGCCAGGGCTACGCCTCCGGCCTGTCGGGCATAGCCTCCGACTA
CGGGGTCGGCGTCTGA

Protein sequence :
MGVSLSKGGNVSLSKEAPGLTAVLVGLGWDVRTTTGTDYDLDASALLCDEAGKVPSNQHFVFYNNLKSPDGSVEHTGDNL
TGEGDGDDESIKVNLAAVPAEITKIVFPVSIHDAESRGQSFGQVRNAFIRVVNQADGNELARYDLSEDAATETAMVFGEL
YRHGAEWKFRAVGQGYASGLSGIASDYGVGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-64 68
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-62 68
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-62 68
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 8e-62 68
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-59 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-58 64
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-27 45
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-27 45
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-29 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD2 YP_004963843.1 tellurium resistance protein BAC0389 Protein 8e-62 67
terD2 YP_004963843.1 tellurium resistance protein BAC0390 Protein 7e-63 64
terD2 YP_004963843.1 tellurium resistance protein BAC0392 Protein 2e-26 44