Gene Information

Name : SBI_04963 (SBI_04963)
Accession : YP_004963214.1
Strain : Streptomyces bingchenggensis BCW-1
Genome accession: NC_016582
Putative virulence/resistance : Resistance
Product : putative TerD-family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 6143796 - 6144371 bp
Length : 576 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCTGTAAGCCTGTCCAAGGGCGGCAACGTCTCGCTCACCAAGGAGGCACCGGGCCTGACCGCCGTCACGGTCGGCCT
CGGCTGGGACGTCCGCACCACCACCGGTACCGACTTCGACCTCGACGCGAGCGCCATCGCCGTGAACCCGAGCGGCAAGG
TCTACTCGGACCAGCACTTCATCTTCTTCAACAACAAGTCGACCCCGGACCAGTCCATCGTCCACACCGGTGACAACGTC
ACCGGCCAGGGCGAGGGCGACGACGAGCAGATCAACGTCAACCTCGCGGCCCTGCCCGCCGACGTCGAGAAGATCGTCTT
CCCGGTCTCCATCTACGACGCGGAGTCCCGCAGCCAGAACTTCGGCCAGGTGCGGAACGCGTTCATCCGCATCATCAACC
AGGCCGGCGGCGCCGAGATCGCCCGCTACGACCTCAGCGAGGACGCGGCCACCGAGACCGCCATGGTCTTCGGCGAGCTG
TACCGCAACGGCGCGGAGTGGAAGTTCCGCGCGGTCGGCCAGGGCTACGCCGCGGGCCTGGCGGGCATCGCCAAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MAVSLSKGGNVSLTKEAPGLTAVTVGLGWDVRTTTGTDFDLDASAIAVNPSGKVYSDQHFIFFNNKSTPDQSIVHTGDNV
TGQGEGDDEQINVNLAALPADVEKIVFPVSIYDAESRSQNFGQVRNAFIRIINQAGGAEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAVGQGYAAGLAGIAKDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-60 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-60 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-60 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-57 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-59 64
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-58 61
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-58 61
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 8e-58 60
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SBI_04963 YP_004963214.1 putative TerD-family protein BAC0390 Protein 2e-59 62
SBI_04963 YP_004963214.1 putative TerD-family protein BAC0389 Protein 3e-57 60