Gene Information

Name : SBI_04643 (SBI_04643)
Accession : YP_004962894.1
Strain : Streptomyces bingchenggensis BCW-1
Genome accession: NC_016582
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5792340 - 5793017 bp
Length : 678 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
GTGCCTTTCCTTCTGCTGATCGAGGACGACGACGCCATCCGCACGGCCCTCGAACTCTCCCTGTCCCGCCAGGGCCACCG
CGTGGCGACGGCGGCGACCGGCGAGGACGGCCTGAAACTGCTGCGCGAGCAGCGGCCGGATCTGATCGTGCTGGATGTGA
TGCTGCCCGGCATCGACGGCTTCGAGGTGTGCCGCCGTATCCGGCGCACCGACCAGCTGCCGATCATCTTGCTGACCGCG
CGGAGCGATGACATCGACGTCGTGGTCGGGCTGGAGTCGGGCGCGGACGACTATGTGGTCAAGCCCGTGCAGGGGCGGGT
GCTCGACGCCCGGATCCGCGCGGTGCTGCGCCGCGGTGAGCGGGAGGCCAATGACTCGGCGTCGTTCGGCTCTCTGGTCA
TCGACCGCGCCGCCATGACCGTGACCAAGAACGGCCAGGATCTCCAGCTCACCCCCACTGAGCTGCGGCTGCTGCTGGAG
CTGAGCCGCAGACCGGGGCAGGCGCTGTCGCGGCAGCAGCTGCTGCGGCTGGTGTGGGAGCACGACTATCTCGGTGACTC
CCGGCTGGTCGACGCCTGCGTACAGCGACTGCGCGCGAAGGTGGAGGACGTACCGTCGTCCCCGACGCTGATCCGTACGG
TGCGTGGGGTCGGATACCGGCTGGACGCGCCACAGTGA

Protein sequence :
MPFLLLIEDDDAIRTALELSLSRQGHRVATAATGEDGLKLLREQRPDLIVLDVMLPGIDGFEVCRRIRRTDQLPIILLTA
RSDDIDVVVGLESGADDYVVKPVQGRVLDARIRAVLRRGEREANDSASFGSLVIDRAAMTVTKNGQDLQLTPTELRLLLE
LSRRPGQALSRQQLLRLVWEHDYLGDSRLVDACVQRLRAKVEDVPSSPTLIRTVRGVGYRLDAPQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-23 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SBI_04643 YP_004962894.1 two-component system response regulator AE000516.2.gene3505. Protein 1e-34 47
SBI_04643 YP_004962894.1 two-component system response regulator NC_002952.2859905.p0 Protein 1e-37 43
SBI_04643 YP_004962894.1 two-component system response regulator NC_002745.1124361.p0 Protein 2e-37 43
SBI_04643 YP_004962894.1 two-component system response regulator NC_009782.5559369.p0 Protein 2e-37 43
SBI_04643 YP_004962894.1 two-component system response regulator NC_002951.3237708.p0 Protein 2e-37 43
SBI_04643 YP_004962894.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-37 43
SBI_04643 YP_004962894.1 two-component system response regulator NC_002758.1121668.p0 Protein 2e-37 43
SBI_04643 YP_004962894.1 two-component system response regulator NC_007622.3794472.p0 Protein 1e-37 43
SBI_04643 YP_004962894.1 two-component system response regulator NC_009641.5332272.p0 Protein 2e-37 43
SBI_04643 YP_004962894.1 two-component system response regulator NC_013450.8614421.p0 Protein 2e-37 43
SBI_04643 YP_004962894.1 two-component system response regulator NC_007793.3914279.p0 Protein 2e-37 43
SBI_04643 YP_004962894.1 two-component system response regulator NC_012469.1.7685629. Protein 1e-38 43
SBI_04643 YP_004962894.1 two-component system response regulator NC_010079.5776364.p0 Protein 3e-31 42
SBI_04643 YP_004962894.1 two-component system response regulator NC_002952.2859858.p0 Protein 3e-31 42
SBI_04643 YP_004962894.1 two-component system response regulator NC_007622.3794948.p0 Protein 3e-31 42
SBI_04643 YP_004962894.1 two-component system response regulator NC_003923.1003417.p0 Protein 3e-31 42
SBI_04643 YP_004962894.1 two-component system response regulator NC_013450.8614146.p0 Protein 3e-31 42
SBI_04643 YP_004962894.1 two-component system response regulator NC_002951.3238224.p0 Protein 3e-31 42
SBI_04643 YP_004962894.1 two-component system response regulator NC_007793.3914065.p0 Protein 3e-31 42
SBI_04643 YP_004962894.1 two-component system response regulator NC_002758.1121390.p0 Protein 3e-31 42
SBI_04643 YP_004962894.1 two-component system response regulator NC_012469.1.7686381. Protein 2e-33 41
SBI_04643 YP_004962894.1 two-component system response regulator BAC0125 Protein 3e-24 41
SBI_04643 YP_004962894.1 two-component system response regulator BAC0197 Protein 1e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SBI_04643 YP_004962894.1 two-component system response regulator VFG1390 Protein 8e-28 42
SBI_04643 YP_004962894.1 two-component system response regulator VFG0596 Protein 6e-24 42
SBI_04643 YP_004962894.1 two-component system response regulator VFG1389 Protein 6e-23 42