Gene Information

Name : SBI_04522 (SBI_04522)
Accession : YP_004962773.1
Strain : Streptomyces bingchenggensis BCW-1
Genome accession: NC_016582
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5656385 - 5657065 bp
Length : 681 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence : 
ATGACCCGAGTACTGCTCGCCGAGGATGACGCATCCATCTCGGAGCCGCTCGCCCGCGCCCTGCGCCGCGAGGGGTACGA
GGTGGAGGTGCGGGAAGACGGACCGACCGCGCTCGACGCCGGTCTGCAGGGAGGCGTCGATCTGCTCGTCCTCGACCTGG
GCCTGCCGGGCATGGACGGCCTGGAGGTCTGCCGCCGGCTGCGTACGGAGGGCCATGGCTTCCCCGTCCTGGTGCTCACC
GCGCGCGCGGACGAGGTGGACACGGTGGTCGGCCTGGACGCCGGCGCCGATGACTACGTCACCAAGCCGTTCCGCCTCGC
CGAGCTGCTGGCCCGGGTGCGGGCCCTGCTGCGGCGCGGCGCCGTCGAGACACAGGCGCAGCAGCCGGCCACCCATGGGG
TGCGTATCGACGTCGAGTCGCACCGCGCCTGGATGGGTGACGAGGAGCTTCAGCTGACCGCCAAGGAATTCGATCTGCTG
CGGGTCCTGGTCCGGGACGCGGGGCGGGTCGTCACCCGCGACCAGCTGATGCGCGAGGTGTGGGACACCACGTGGTGGTC
GTCGACCAAGACGCTCGATATGCATATCTCCTGGCTCCGCAAGAAGCTCGGCGACGACGCGGCCAACCCCCGGTACATCG
CCACCGTGCGCGGAGTCGGATTCCGGTTCGAGAAAAGCTGA

Protein sequence : 
MTRVLLAEDDASISEPLARALRREGYEVEVREDGPTALDAGLQGGVDLLVLDLGLPGMDGLEVCRRLRTEGHGFPVLVLT
ARADEVDTVVGLDAGADDYVTKPFRLAELLARVRALLRRGAVETQAQQPATHGVRIDVESHRAWMGDEELQLTAKEFDLL
RVLVRDAGRVVTRDQLMREVWDTTWWSSTKTLDMHISWLRKKLGDDAANPRYIATVRGVGFRFEKS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-13 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SBI_04522 YP_004962773.1 two-component system response regulator AE000516.2.gene3505. Protein 1e-28 45
SBI_04522 YP_004962773.1 two-component system response regulator BAC0083 Protein 4e-19 43
SBI_04522 YP_004962773.1 two-component system response regulator NC_002952.2859905.p0 Protein 2e-28 41
SBI_04522 YP_004962773.1 two-component system response regulator NC_002951.3237708.p0 Protein 2e-28 41
SBI_04522 YP_004962773.1 two-component system response regulator NC_002758.1121668.p0 Protein 2e-28 41
SBI_04522 YP_004962773.1 two-component system response regulator NC_009641.5332272.p0 Protein 2e-28 41
SBI_04522 YP_004962773.1 two-component system response regulator NC_013450.8614421.p0 Protein 2e-28 41
SBI_04522 YP_004962773.1 two-component system response regulator NC_007793.3914279.p0 Protein 2e-28 41
SBI_04522 YP_004962773.1 two-component system response regulator NC_007622.3794472.p0 Protein 3e-28 41
SBI_04522 YP_004962773.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-28 41
SBI_04522 YP_004962773.1 two-component system response regulator NC_002745.1124361.p0 Protein 2e-28 41
SBI_04522 YP_004962773.1 two-component system response regulator NC_009782.5559369.p0 Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SBI_04522 YP_004962773.1 two-component system response regulator VFG1390 Protein 5e-26 45
SBI_04522 YP_004962773.1 two-component system response regulator VFG0596 Protein 5e-14 43
SBI_04522 YP_004962773.1 two-component system response regulator VFG0473 Protein 1e-16 41
SBI_04522 YP_004962773.1 two-component system response regulator VFG1389 Protein 2e-21 41