Gene Information

Name : marA (EcWSU1_02172)
Accession : YP_004952030.1
Strain : Enterobacter cloacae EcWSU1
Genome accession: NC_016514
Putative virulence/resistance : Resistance
Product : multiple antibiotic resistance protein marA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2246598 - 2246984 bp
Length : 387 bp
Strand : -
Note : -

DNA sequence : 
ATGACGATGTCCAGACGCAATACTGACGCTATTACTATTCATAGCATTTTGGACTGGATCGAAGATAACCTGGAATCGCC
GCTCTCCCTTGAAAAAGTGTCAGAGCGTTCAGGTTACTCCAAATGGCACCTGCAACGGATGTTCAAAAAAGAGACCGGCC
ATTCATTAGGTCAATATATTCGCAGCCGCAAGCTGACGGAAATTGCCCAGAAGCTGAAAGAAAGCAATGAGCCGATCCTT
TATCTGGCGGAACGTTACGGTTTTGAATCACAGCAAACCCTGACGCGTACGTTTAAGAACTACTTCGACGTGCCGCCTCA
CAAATACCGTATTACCAGCGTGCCGGGTGAATCCCGATACCTGTATCCACTAAAACATTGTAGTTAA

Protein sequence : 
MTMSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKLTEIAQKLKESNEPIL
YLAERYGFESQQTLTRTFKNYFDVPPHKYRITSVPGESRYLYPLKHCS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 8e-21 45
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 8e-21 45
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 1e-19 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_004952030.1 multiple antibiotic resistance protein marA CP001918.1.gene2033. Protein 2e-56 100
marA YP_004952030.1 multiple antibiotic resistance protein marA CP000647.1.gene1624. Protein 6e-53 95
marA YP_004952030.1 multiple antibiotic resistance protein marA CP001138.1.gene1637. Protein 2e-52 95
marA YP_004952030.1 multiple antibiotic resistance protein marA NC_002695.1.917339.p Protein 1e-52 93
marA YP_004952030.1 multiple antibiotic resistance protein marA BAC0560 Protein 1e-52 93
marA YP_004952030.1 multiple antibiotic resistance protein marA CP000034.1.gene1596. Protein 2e-53 92
marA YP_004952030.1 multiple antibiotic resistance protein marA CP001138.1.gene612.p Protein 9e-23 45
marA YP_004952030.1 multiple antibiotic resistance protein marA NC_010558.1.6276025. Protein 4e-21 45
marA YP_004952030.1 multiple antibiotic resistance protein marA CP000034.1.gene4505. Protein 2e-19 43
marA YP_004952030.1 multiple antibiotic resistance protein marA BAC0371 Protein 1e-19 43
marA YP_004952030.1 multiple antibiotic resistance protein marA CP001138.1.gene4488. Protein 3e-20 43
marA YP_004952030.1 multiple antibiotic resistance protein marA NC_002695.1.914293.p Protein 1e-19 43
marA YP_004952030.1 multiple antibiotic resistance protein marA CP001918.1.gene327.p Protein 2e-20 43
marA YP_004952030.1 multiple antibiotic resistance protein marA CP000647.1.gene4499. Protein 5e-20 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_004952030.1 multiple antibiotic resistance protein marA VFG1038 Protein 3e-21 45
marA YP_004952030.1 multiple antibiotic resistance protein marA VFG0585 Protein 3e-20 43