Gene Information

Name : DSC_05155 (DSC_05155)
Accession : YP_004929725.1
Strain : Pseudoxanthomonas spadix BD-a59
Genome accession: NC_016147
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 915347 - 915919 bp
Length : 573 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCAGTCAATCTTCAGAAGGGTCAGAAGATCTCGCTGGAAAAAGCGGACGGTAGCTCGCTGTCGCAGATCTCGATGGG
GCTGGGCTGGGATGTCGCGAAGGGCATATTCGGTATCGGCGGTGGCAGCATTGATCTAGACGCGTCATGCGTAATGTTCG
ACGAACTCAAGCGCGTGACGGACACCGTATGGTTCCGCCAGCTGCAGAGCCGAGACGGGAGCATCCGTCACTCAGGCGAC
AATCGCACCGGCGACGGCGATGGCGACGACGAGACGATTCACGTTGATCTCAACCGGGTGCCCAGCGAGGTTAAAAGCCT
GGTCTTCACGGTCAACAGTTTCACGGGGCAGAATTTCGGCAAGGTCGCCAATGCCACCTGTCGACTTATCGACAATACCA
ACAGGACCGAAGTCGCTAAACTCGACCTAAGCGACGTGAAGGGACCGCACACCGCCATGATCATGGCGAAGGTGTATCGC
CACAACGGCGCCTGGAAGATGCATGCCATCGGCGCGAACGCTACTGGGCGCACGTTCCAGGACCTGCTGCCCCGCATTCT
CCCGCATCTGTAA

Protein sequence :
MAVNLQKGQKISLEKADGSSLSQISMGLGWDVAKGIFGIGGGSIDLDASCVMFDELKRVTDTVWFRQLQSRDGSIRHSGD
NRTGDGDGDDETIHVDLNRVPSEVKSLVFTVNSFTGQNFGKVANATCRLIDNTNRTEVAKLDLSDVKGPHTAMIMAKVYR
HNGAWKMHAIGANATGRTFQDLLPRILPHL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-41 53
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-29 47
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-29 47
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-27 44
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 42
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 42
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-22 41
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DSC_05155 YP_004929725.1 stress protein BAC0392 Protein 1e-30 47
DSC_05155 YP_004929725.1 stress protein BAC0389 Protein 1e-25 42
DSC_05155 YP_004929725.1 stress protein BAC0390 Protein 1e-23 41