Gene Information

Name : Sfla_2807 (Sfla_2807)
Accession : YP_004923752.1
Strain : Streptomyces flavogriseus ATCC 33331
Genome accession: NC_016114
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 3278152 - 3278727 bp
Length : 576 bp
Strand : +
Note : PFAM: stress protein; KEGG: sgr:SGR_4049 TerD-family protein

DNA sequence : 
ATGGCTGTAAGCCTGTCCAAGGGCGGCAACGTCTCGCTCACCAAGGAGGCCCCGGGCCTGACCGCCGTCACGGTCGGCCT
CGGCTGGGACGTCCGCACCACCACCGGCACCGACTTCGACCTCGACGCCTCGGCGATCGCGGTCAACAACGCCGGCAAGG
TCTACTCCGACGGCCACTTCGTCTTCTTCAACAACAAGGCGACGCCGGACCAGACCATCGTCCACACCGGTGACAACATC
ACCGGCCAGGGCGAGGGCGACGACGAGCAGATCAACGTCAACCTGGCGGGCCTCCCGGCGGACATCGACAAGATCGTGTT
CCCGGTCTCCATCTACGACGCCGAGGCGCGCAGCCAGAACTTCGGGCAGGTGCGGAACGCCTTCATCCGCATCGTCAACC
AGGCCGGCGGCACCGAGATCGCCCGCTACGACCTCAGCGAGGACGCCGCCACCGAGACCGCGATGGTCTTCGGCGAGCTC
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCGGTCGGCCAGGGTTACGCATCGGGTCTGCGCGGCATCGCCCAGGACTT
CGGCGTCAACCTCTGA

Protein sequence : 
MAVSLSKGGNVSLTKEAPGLTAVTVGLGWDVRTTTGTDFDLDASAIAVNNAGKVYSDGHFVFFNNKATPDQTIVHTGDNI
TGQGEGDDEQINVNLAGLPADIDKIVFPVSIYDAEARSQNFGQVRNAFIRIVNQAGGTEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAVGQGYASGLRGIAQDFGVNL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-60 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-58 64
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-58 63
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 60
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 60
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-57 60
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfla_2807 YP_004923752.1 stress protein BAC0390 Protein 1e-58 62
Sfla_2807 YP_004923752.1 stress protein BAC0389 Protein 2e-56 60