Gene Information

Name : Sfla_1927 (Sfla_1927)
Accession : YP_004922878.1
Strain : Streptomyces flavogriseus ATCC 33331
Genome accession: NC_016114
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2347120 - 2347779 bp
Length : 660 bp
Strand : -
Note : KEGG: sgr:SGR_2135 two-component system response regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver; transcriptional regulator domain-containing protein

DNA sequence : 
ATGCGCCTGTTGATCGTGGAGGACGAGAAGCGCCTCGCCACGTCCCTCGCGAGGGGGCTGACCGCCGAGGGCTTCGCCGT
CGACGTCGTGCACGACGGACTGGAGGGCCTGCACCTGGCCGGCCAGGGCGTGTACGACCTCGTGGTCCTCGACATCATGC
TCCCCGGGATGAACGGCTACCGGATCTGCGCCGCCCTGCGGGCCGCCGGGCACGAGACGCCGATCCTGATGCTGACCGCG
AAGGACGGGGAGTACGACGAGGCGGAGGGTTTGGACACGGGCGCCGACGACTACCTGACCAAGCCGTTCTCGTACGTCGT
TCTCGTCGCCCGTGTCAGGGCGCTGCTGCGCCGCCGCGGCGGCTCCGCCTCGCCGGTGCTGACCGCCGGGACGCTGCGGA
TGGACACCGCCGCCCGGCGGGTGCACCGGGGCGAGGACGAAGTCACCCTCACGACGAAGGAGTTCGCGGTCCTGGAACAG
CTCGTGCGGCGGGCGGGCGAGGTGGTCAGCAAGGCGGACATCCTGGAGCACGTCTGGGACTTCGCCTACGACGGCGACCC
GAACATCGTCGAGGTCTACATCAGCACCCTGCGCCGCAAGCTCGGCGCCGCGGCGATCCGTACGGTACGCGGCGCCGGCT
ACCGGCTGGAGGCGCTGTGA

Protein sequence : 
MRLLIVEDEKRLATSLARGLTAEGFAVDVVHDGLEGLHLAGQGVYDLVVLDIMLPGMNGYRICAALRAAGHETPILMLTA
KDGEYDEAEGLDTGADDYLTKPFSYVVLVARVRALLRRRGGSASPVLTAGTLRMDTAARRVHRGEDEVTLTTKEFAVLEQ
LVRRAGEVVSKADILEHVWDFAYDGDPNIVEVYISTLRRKLGAAAIRTVRGAGYRLEAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-36 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-35 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator BAC0197 Protein 7e-38 49
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-36 46
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-38 46
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator BAC0308 Protein 5e-38 46
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 8e-28 46
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-39 45
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 3e-27 45
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-32 44
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator BAC0638 Protein 8e-30 44
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator BAC0487 Protein 1e-24 43
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 2e-25 42
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-36 45
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-30 43
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-30 42
Sfla_1927 YP_004922878.1 winged helix family two component transcriptional regulator VFG1390 Protein 7e-38 41