Gene Information

Name : SCAT_p0937 (SCAT_p0937)
Accession : YP_004920228.1
Strain :
Genome accession: NC_016113
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1017142 - 1017378 bp
Length : 237 bp
Strand : -
Note : Evidence 4 : Homologs of previously reported genes of unknown function

DNA sequence :
GTGACGCATGTCGCCCGCGACCTCGGCATCCACAAGGAGGCCCTGCGGTCATGGGTTCGCCAGGCCGAGGCCGACGCCGG
CGAGCGCGACGACCGCCTGACCAGCTCCGAGCTGGAGGAGCTGAAGCAACTCCGGAAAGAGAATGCCGAGTTGAGGCGGG
CCAACGAGATTCTCAAGGCCGCCAGCGTGTTTTTTGCCCAGGAGATCGACCGTCCCCGGACGAGGCCGAGCAGGTGA

Protein sequence :
MTHVARDLGIHKEALRSWVRQAEADAGERDDRLTSSELEELKQLRKENAELRRANEILKAASVFFAQEIDRPRTRPSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 5e-09 48
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 5e-09 48
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 5e-09 48
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 4e-10 47
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 4e-10 47
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 2e-06 47
unnamed AAF09023.1 unknown Not tested SHI-O Protein 5e-07 47
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 5e-07 47
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 5e-10 47
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 5e-07 47
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 5e-10 47
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 7e-07 47
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-07 47
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 5e-10 47
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 7e-07 47
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 4e-10 47
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 5e-10 47
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 7e-07 47
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 4e-10 47
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 5e-10 47
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 7e-07 47
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 7e-06 45
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 1e-05 45
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 6e-06 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCAT_p0937 YP_004920228.1 hypothetical protein VFG0643 Protein 2e-07 47
SCAT_p0937 YP_004920228.1 hypothetical protein VFG1603 Protein 8e-07 47
SCAT_p0937 YP_004920228.1 hypothetical protein VFG0606 Protein 2e-06 45