Name : SCAT_p0002 (SCAT_p0002) Accession : YP_004919296.1 Strain : Genome accession: NC_016113 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 745 - 981 bp Length : 237 bp Strand : + Note : Evidence 4 : Homologs of previously reported genes of unknown function DNA sequence : GTGACGCATGTCGCCCGCGACCTCGGCATCCACAAGGAGGCCCTGCGGTCATGGGTTCGCCAGGCCGAGGCCGACGCCGG CGAGCGCGACGACCGCCTGACCAGCTCCGAGCTGGAGGAGCTGAAGCAACTCCGGAAAGAGAATGCCGAGTTGAGGCGGG CCAACGAGATTCTCAAGGCCGCCAGCGTGTTTTTTGCCCAGGAGATCGACCGTCCCCGGACGAGGCCGAGCAGGTGA Protein sequence : MTHVARDLGIHKEALRSWVRQAEADAGERDDRLTSSELEELKQLRKENAELRRANEILKAASVFFAQEIDRPRTRPSR |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ECO111_3720 | YP_003236060.1 | putative IS629 transposase OrfA | Not tested | LEE | Protein | 5e-09 | 48 |
ECO111_3775 | YP_003236110.1 | putative IS629 transposase OrfA | Not tested | LEE | Protein | 5e-09 | 48 |
Z4335 | NP_289560.1 | hypothetical protein | Not tested | OI-122 | Protein | 5e-09 | 48 |
unnamed | AAL67399.1 | TnpE-like protein | Not tested | PAI II CFT073 | Protein | 5e-07 | 47 |
Z1199 | NP_286734.1 | hypothetical protein | Not tested | TAI | Protein | 5e-10 | 47 |
c5168 | NP_757016.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 7e-07 | 47 |
unnamed | ADD91740.1 | hypothetical protein | Not tested | PAI-I AL862 | Protein | 5e-07 | 47 |
Z1222 | NP_286757.1 | hypothetical protein | Not tested | TAI | Protein | 5e-10 | 47 |
c5214 | NP_757062.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 7e-07 | 47 |
IS629 | CAC37925.1 | hypothetical protein | Not tested | LEE | Protein | 4e-10 | 47 |
Z1639 | NP_287142.1 | hypothetical protein | Not tested | TAI | Protein | 5e-10 | 47 |
S3184 | NP_838467.1 | IS629 orfA | Not tested | SHI-1 | Protein | 7e-07 | 47 |
IS629 | CAI43820.1 | hypothetical protein | Not tested | LEE | Protein | 4e-10 | 47 |
Z1661 | NP_287163.1 | hypothetical protein | Not tested | TAI | Protein | 5e-10 | 47 |
SF2979 | NP_708753.1 | IS629 ORF1 | Not tested | SHI-1 | Protein | 7e-07 | 47 |
IS629 | CAI43841.1 | hypothetical protein | Not tested | LEE | Protein | 4e-10 | 47 |
IS629 | CAI43908.1 | hypothetical protein 1 | Not tested | LEE | Protein | 4e-10 | 47 |
unnamed | CAD42084.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 2e-06 | 47 |
unnamed | AAF09023.1 | unknown | Not tested | SHI-O | Protein | 5e-07 | 47 |
tnpE | AAD44738.1 | TnpE | Not tested | SHI-2 | Protein | 5e-07 | 47 |
ECO103_3584 | YP_003223442.1 | IS629 transposase OrfA | Not tested | LEE | Protein | 5e-10 | 47 |
ORF_36 | AAZ04445.1 | conserved hypothetical protein | Not tested | PAI I APEC-O1 | Protein | 7e-06 | 45 |
APECO1_3498 | YP_854313.1 | transposase; OrfA protein of insertion sequence IS629 | Not tested | PAI I APEC-O1 | Protein | 1e-05 | 45 |
SF3706 | NP_709445.1 | IS629 ORF1 | Not tested | SHI-2 | Protein | 6e-06 | 45 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
SCAT_p0002 | YP_004919296.1 | hypothetical protein | VFG1603 | Protein | 8e-07 | 47 |
SCAT_p0002 | YP_004919296.1 | hypothetical protein | VFG0643 | Protein | 2e-07 | 47 |
SCAT_p0002 | YP_004919296.1 | hypothetical protein | VFG0606 | Protein | 2e-06 | 45 |