Gene Information

Name : SCAT_p1277 (SCAT_p1277)
Accession : YP_004920565.1
Strain :
Genome accession: NC_016113
Putative virulence/resistance : Resistance
Product : Multidrug resistance protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 1368227 - 1368550 bp
Length : 324 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; PubMedId : 10735876, 15849754, 16750162, 16850406; Product type t : transporter

DNA sequence :
GTGGCCTATCTGTTCCTGCTCCTGGCGATCATCACCGAGGTGGCCGGCACCAGCCTGTTGAAGGCCACCGCCGGCTTCAC
CCGGCTGTGGCCCACCGCGGCCTGTCTGGCGTGCTACGCCGTGGCGTTCCTCGCCCTGGCGCGGGCCATCGGCCGCGGGC
TGCACGTCGGTGTCGGATACGCGATGTGGTCCGGGCTCGGCACCACGCTGATCGTGCTGATCGGCGCGTTGTTCCTGCAC
GAACCGCTCACCGCGGCGAAGGTGCTCGGCGTGGCGCTGGTGATCGCCGGGGTCGTGGTGCTCAACCTGGGCGGTGCCCA
TTGA

Protein sequence :
MAYLFLLLAIITEVAGTSLLKATAGFTRLWPTAACLACYAVAFLALARAIGRGLHVGVGYAMWSGLGTTLIVLIGALFLH
EPLTAAKVLGVALVIAGVVVLNLGGAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 8e-09 42
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 8e-09 42
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 8e-09 42
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-08 42
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 8e-09 42
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 8e-09 42
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 8e-09 42
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-08 42
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 8e-09 42
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 8e-09 42
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 8e-09 42
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-08 42
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 8e-09 42
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 8e-09 42
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 8e-09 42
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 8e-09 42
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 8e-09 42
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 8e-09 42
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 8e-09 42
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 8e-09 42
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 8e-09 42
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 8e-09 42
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 8e-09 42
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 8e-09 42
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 8e-09 42
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-08 42
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 8e-09 42
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 8e-09 42
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 8e-09 42
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-08 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCAT_p1277 YP_004920565.1 Multidrug resistance protein BAC0249 Protein 2e-19 55
SCAT_p1277 YP_004920565.1 Multidrug resistance protein AE000516.2.gene3301. Protein 2e-19 55
SCAT_p1277 YP_004920565.1 Multidrug resistance protein CP001138.1.gene1489. Protein 1e-08 44
SCAT_p1277 YP_004920565.1 Multidrug resistance protein NC_010410.6003348.p0 Protein 2e-08 43
SCAT_p1277 YP_004920565.1 Multidrug resistance protein BAC0002 Protein 2e-08 43
SCAT_p1277 YP_004920565.1 Multidrug resistance protein BAC0322 Protein 3e-09 42
SCAT_p1277 YP_004920565.1 Multidrug resistance protein BAC0323 Protein 4e-09 42
SCAT_p1277 YP_004920565.1 Multidrug resistance protein BAC0327 Protein 3e-13 41
SCAT_p1277 YP_004920565.1 Multidrug resistance protein NC_002695.1.913273.p Protein 2e-11 41
SCAT_p1277 YP_004920565.1 Multidrug resistance protein BAC0150 Protein 2e-11 41