Gene Information

Name : MEALZ_3675 (MEALZ_3675)
Accession : YP_004918915.1
Strain : Methylomicrobium alcaliphilum 20Z
Genome accession: NC_016112
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 4242431 - 4242781 bp
Length : 351 bp
Strand : +
Note : Evidence 4 : Homologs of previously reported genes of unknown function

DNA sequence :
ATGTCTGGCTTGATTGAGAGTCCGGCGCAAATCTGGCTGGCGGTCGAGCCGGTCGATATGAGGCGGGGCATCGATGGCTT
GTCGGCGATTGTCCAACAGCGCTTAGGTTATGCGCCGTGCGCCGGGGCGGCGTTTATTTTTCGTAATCGCGCCGGTAATC
GTTTGAAAGTGTTGCTGTGGGACGGCAATGGCGTTTGGCTGTGTCAGCGGCGTCTGCATCGAGGCTCGTTTACCTGGCCC
AAGGCCTCCGAAACCGTATTTGCCCTGAGTCAGGCGCAGTGGCAATGGTTGATTGCCGGTGTCGATTGGCAGCGCTTATC
GGCGTCATCGTCAGCCGATTGGCAAGTCTAA

Protein sequence :
MSGLIESPAQIWLAVEPVDMRRGIDGLSAIVQQRLGYAPCAGAAFIFRNRAGNRLKVLLWDGNGVWLCQRRLHRGSFTWP
KASETVFALSQAQWQWLIAGVDWQRLSASSSADWQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1163 NP_286698.1 hypothetical protein Not tested TAI Protein 1e-23 51
Z1602 NP_287106.1 hypothetical protein Not tested TAI Protein 1e-23 51
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 3e-11 46
EXB18 ABD94704.1 ISPpu14 transposase Orf2 Not tested ExoU island B Protein 4e-13 45
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 7e-15 45
unnamed AAL99258.1 unknown Not tested LEE Protein 7e-15 45
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 7e-15 45
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-14 45
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-14 45
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-14 45
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-14 45
unnamed AAC31493.1 L0014 Not tested LEE Protein 7e-15 45
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-14 45
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-14 45
unnamed ABR13518.1 transposase Not tested PAGI-7 Protein 1e-13 44
tnpB AEZ06052.1 transposition helper protein Not tested Tn6167 Protein 2e-16 44
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-14 44
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-14 44
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-14 44
RL060 AAP84185.1 transposase Not tested PAPI-1 Protein 9e-13 42
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MEALZ_3675 YP_004918915.1 hypothetical protein VFG1517 Protein 1e-11 46
MEALZ_3675 YP_004918915.1 hypothetical protein VFG1709 Protein 3e-15 45
MEALZ_3675 YP_004918915.1 hypothetical protein VFG0792 Protein 3e-15 45
MEALZ_3675 YP_004918915.1 hypothetical protein VFG1698 Protein 7e-15 44
MEALZ_3675 YP_004918915.1 hypothetical protein VFG1052 Protein 8e-15 44