Gene Information

Name : mprA (MEALZ_1701)
Accession : YP_004916982.1
Strain : Methylomicrobium alcaliphilum 20Z
Genome accession: NC_016112
Putative virulence/resistance : Virulence
Product : two-component signal transduction system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1954915 - 1955601 bp
Length : 687 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; Product type r : regulator

DNA sequence :
ATGAGTATTTTATTGGTTGAAGACGATAGAAAAGCGTCCGGTCTTTTAATACGGGGCCTGACCGAAGAAGGTTTTGCAGT
CGATCCGGCATACTCGGTCGAGGAAGCCGAACAGTGCCTGCGCATACAGGAGTATCGCTTGATTATTTTAGATTGGTTTT
TGCCGGGCAAGCAGGGTGTTGCTTGGTGTGAAGAACTCCGGCAACAAGGCGTGCGAGTGCCGATTTTGATGCTCACCGCC
CGAGATGCCTTGCAAGACCGGGTCGAAGGGCTCGACGCCGGTGCCGACGATTACTTGACTAAACCGTTTGCGTTCGAGGA
ACTGTTGGCGAGAACCCGCGCCTTATTGCGCCGTTCGGACATTGGTCAACAGACAAGTCTTGAGGTGGCCGACCTCATAT
TGGATACACAAACGCGCCGGGTAACCAGGGGCCAGTTGATTATCAATTTGACCCAAAAGGAATACGCCATTCTGGAAATG
TTAATGCGTCGCGTAGATAGGGTAGTAAGCCGAAACGAACTTGCGGAATCGCTATGGAGCAACGACCATATTGGCCTGAA
TAATCTGATCGACGCTCATATTCGCAATTTGCGCCGGAAAATCGATCGCCCGGGCGTTACGCAACTCATCCATACGGTTC
GCGGCCGAGGATTCCGACTGATAACAAGCGGTGCCGACGATGCTTAA

Protein sequence :
MSILLVEDDRKASGLLIRGLTEEGFAVDPAYSVEEAEQCLRIQEYRLIILDWFLPGKQGVAWCEELRQQGVRVPILMLTA
RDALQDRVEGLDAGADDYLTKPFAFEELLARTRALLRRSDIGQQTSLEVADLILDTQTRRVTRGQLIINLTQKEYAILEM
LMRRVDRVVSRNELAESLWSNDHIGLNNLIDAHIRNLRRKIDRPGVTQLIHTVRGRGFRLITSGADDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-28 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_004916982.1 two-component signal transduction system response regulator BAC0197 Protein 3e-31 46
mprA YP_004916982.1 two-component signal transduction system response regulator BAC0083 Protein 1e-31 45
mprA YP_004916982.1 two-component signal transduction system response regulator BAC0347 Protein 2e-27 44
mprA YP_004916982.1 two-component signal transduction system response regulator BAC0638 Protein 7e-25 44
mprA YP_004916982.1 two-component signal transduction system response regulator BAC0125 Protein 2e-31 44
mprA YP_004916982.1 two-component signal transduction system response regulator NC_002516.2.879194.p Protein 1e-26 44
mprA YP_004916982.1 two-component signal transduction system response regulator BAC0308 Protein 1e-27 43
mprA YP_004916982.1 two-component signal transduction system response regulator BAC0111 Protein 2e-30 41
mprA YP_004916982.1 two-component signal transduction system response regulator BAC0288 Protein 2e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_004916982.1 two-component signal transduction system response regulator VFG1390 Protein 2e-30 44
mprA YP_004916982.1 two-component signal transduction system response regulator VFG0596 Protein 6e-29 42
mprA YP_004916982.1 two-component signal transduction system response regulator VFG0473 Protein 1e-26 41