Gene Information

Name : yceD (SCAT_1478)
Accession : YP_004911005.1
Strain : Streptomyces cattleya NRRL 8057
Genome accession: NC_016111
Putative virulence/resistance : Resistance
Product : stress adaptation protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1597873 - 1598448 bp
Length : 576 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pf : factor

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGTGGCAACGTCTCGCTGACCAAGGAGGCGCCCAACCTCACCGCCGTCCACGTCGGCCT
CGGCTGGGACGCGCGCACCACCACCGGCGCCGACTTCGACCTGGACGCCAGCGCCCTGCTGACCGACGCGGCCGGCAAGG
TCCTCACGGACCAGCACTTCGTCTTCTTCAACAACCTCAAGAGCCCGGACGGCTCGGTCGAGCACACCGGGGACAACCTC
ACCGGTGAGGGCGAGGGCGACGACGAGGTGATCAACGTCGACCTGGCCGCCGTCCCGGCCGACGTCGCCAAGATCGTCTT
CCCGGTCTCCATCTACGAGGCCGAGAGCCGCCAGCAGAGCTTCGGCCAGGTGCGCAACGCCTACATCCGGGTGGTCAACC
AGGCCGACCAGAAGGAGATCGCCCGCTACGACCTCACCGAGGACGCCTCCACCGAGACCGCCATGGTCTTCGGCGAGCTG
TACCGCAACGGCGCCGAGTGGAAGTTCCGGGCCATCGGCCAGGGGTACGCCTCCGGACTGCGCGGCATCGCCCAGGACTT
CGGCGTCAACGTCTAG

Protein sequence :
MGVSLSKGGNVSLTKEAPNLTAVHVGLGWDARTTTGADFDLDASALLTDAAGKVLTDQHFVFFNNLKSPDGSVEHTGDNL
TGEGEGDDEVINVDLAAVPADVAKIVFPVSIYEAESRQQSFGQVRNAYIRVVNQADQKEIARYDLTEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLRGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-52 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-53 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-54 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-54 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-54 64
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-53 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-53 64
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-55 64
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 44
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-28 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceD YP_004911005.1 stress adaptation protein BAC0389 Protein 7e-54 66
yceD YP_004911005.1 stress adaptation protein BAC0390 Protein 6e-54 64
yceD YP_004911005.1 stress adaptation protein BAC0392 Protein 2e-26 44