Gene Information

Name : KSE_68310 (KSE_68310)
Accession : YP_004908545.1
Strain : Kitasatospora setae KM-6054
Genome accession: NC_016109
Putative virulence/resistance : Resistance
Product : putative tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 7699521 - 7700096 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGGAGTCTCGCTCGCCAAGGGCGGAAACGTCTCGCTGACGAAGGAGGCCCCGGGGCTCACCAACGTCATCGTCGGCCT
GGGCTGGGACGTCCGGGCCACCACGGGCGCCGACTTCGACCTGGACGCCAGCGCGATGCTGTGCGGCGAGGGCGGCCGGG
TGCTCAGCGACCAGCACTTCGTCTTCTACAACAACCTGCGCAGCCCCGAGGGCTCGGTCGAGCACAGCGGCGACAACCTG
ACCGGTGGCGGCGACGGCGACGACGAGCAGATCAAGGTCGACCTGACGGCCATTCCGCCGCAGGTCGCCAAGGTGGTCTT
CCCGGTGTCGATCTACGACGCGGAGAACCGCCACCAGAGCTTCGGCCAGGTCCGCAACGCGTTCATCCGGGTCGTCAACG
AGGCCGACGGCAGCGAGGTCGCCCGCTACGACCTCTCGGAGGACGCGTCGACCGAGACCGCGATGGTCTTCGGCGAGCTG
TACCGCTACGGCAGCGAGTGGAAGTTCCGTGCCATCGGCCAGGGTTACGCCTCCGGCCTGCGGGGCATCGCGCTCGACTA
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLAKGGNVSLTKEAPGLTNVIVGLGWDVRATTGADFDLDASAMLCGEGGRVLSDQHFVFYNNLRSPEGSVEHSGDNL
TGGGDGDDEQIKVDLTAIPPQVAKVVFPVSIYDAENRHQSFGQVRNAFIRVVNEADGSEVARYDLSEDASTETAMVFGEL
YRYGSEWKFRAIGQGYASGLRGIALDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-58 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-56 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-56 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-56 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-54 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-55 64
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-55 64
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-55 63
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-24 42
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-22 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KSE_68310 YP_004908545.1 putative tellurium resistance protein BAC0390 Protein 3e-58 65
KSE_68310 YP_004908545.1 putative tellurium resistance protein BAC0389 Protein 1e-54 63