Gene Information

Name : KSE_05880 (KSE_05880)
Accession : YP_004902387.1
Strain : Kitasatospora setae KM-6054
Genome accession: NC_016109
Putative virulence/resistance : Virulence
Product : putative two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 658324 - 659001 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
ATGCGCGTACTGGTGGTGGAGGACGAACAGCGGCTCGCCCTGGCGATCAAGCACGGACTGGAGGCCGAGGGCTTCACGGT
CGACACCGTGCACGACGGGCTGTCCGGGCTGGCCCGGGCCACCGACCACTCGTACGACGTGGTCATCCTCGACATCATGC
TGCCCGGCCTCAACGGCTACCGGGTCTGCGCCCGGCTCCGGGCGGCCGGCAGCGACGCCGGGATCCTGATGCTGACCGCC
AAGGACGGCGAGTGGGACGAGGCCGAGGCGCTGGACACCGGAGCCGACGACTACCTCTCCAAGCCGTTCTCGTTCGTCGT
CCTGGTCGCCCGGCTGAAGGCGCTCGCCCGCCGGATCGGCTCCCGCGCCCCGCGCCGCGCCGTCCTCGGCGACCTGGTGG
TCGACTCCGCCGCCCGCACCTGCAGCCGGGCGGGCCGGCCGATCGCGCTCACCCCGCGCGAGTTCGCCGTCCTCGACCAC
CTGGCCCGGCGGGCCGGCGAGGCCGTCTCCAAGCGGGAGATCCTCGAACAGGTCTGGGACGCCGCCGCCGACAGCGACCC
CAACACCGTCGAGGTGCACATCAGCGCGCTGCGCCGCAAGATCGACACCCCGTTCGGGCGCAGCGCCCTGCAGACCGTGC
GCGGCGCGGGCTACCGGCTGGAGCCCGACGGTGGCTGA

Protein sequence :
MRVLVVEDEQRLALAIKHGLEAEGFTVDTVHDGLSGLARATDHSYDVVILDIMLPGLNGYRVCARLRAAGSDAGILMLTA
KDGEWDEAEALDTGADDYLSKPFSFVVLVARLKALARRIGSRAPRRAVLGDLVVDSAARTCSRAGRPIALTPREFAVLDH
LARRAGEAVSKREILEQVWDAAADSDPNTVEVHISALRRKIDTPFGRSALQTVRGAGYRLEPDGG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-38 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-37 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KSE_05880 YP_004902387.1 putative two-component system response regulator BAC0083 Protein 3e-42 46
KSE_05880 YP_004902387.1 putative two-component system response regulator BAC0638 Protein 3e-35 45
KSE_05880 YP_004902387.1 putative two-component system response regulator BAC0197 Protein 7e-40 45
KSE_05880 YP_004902387.1 putative two-component system response regulator BAC0125 Protein 3e-40 44
KSE_05880 YP_004902387.1 putative two-component system response regulator BAC0308 Protein 2e-42 44
KSE_05880 YP_004902387.1 putative two-component system response regulator U82965.2.orf14.gene. Protein 1e-30 44
KSE_05880 YP_004902387.1 putative two-component system response regulator BAC0111 Protein 1e-39 43
KSE_05880 YP_004902387.1 putative two-component system response regulator Y16952.3.orf35.gene. Protein 6e-25 42
KSE_05880 YP_004902387.1 putative two-component system response regulator BAC0347 Protein 5e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KSE_05880 YP_004902387.1 putative two-component system response regulator VFG0596 Protein 2e-38 43
KSE_05880 YP_004902387.1 putative two-component system response regulator VFG1386 Protein 2e-35 43
KSE_05880 YP_004902387.1 putative two-component system response regulator VFG1389 Protein 3e-29 41