Gene Information

Name : KSE_58490 (KSE_58490)
Accession : YP_004907575.1
Strain : Kitasatospora setae KM-6054
Genome accession: NC_016109
Putative virulence/resistance : Resistance
Product : putative tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 6560112 - 6560687 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
GTGGGAGTCTCGCTCAGCAAGGGTGGCAACGTCTCGCTCACCAAGGAGGCACCCGGCCTGACCGCCGTGGTCGTCGGCCT
CGGCTGGGACGTCCGCACCACCACCGGCACCGACTTCGACCTCGACGCCAGCGCGCTGCTCTGCACCGAACAGGGCAAGG
TCCGCTCCGACGGGGACTTCGTCTTCTTCAACAACCTGAAGAGCGCCGACGGTTCGGTCGAGCACACCGGCGACAACCTC
ACCGGCGAAGGCGACGGCGACGACGAGCAGGTCAAGGTGAACCTGGCCGCCGTCCCCGCCGAGATCACCCGGATCGTCTT
CCCCGTCGCGATCTACGACGCGGCGAACCGGCAGCAGAGCTTCGGCCAGGTCCGCAACGCCTACATCCGCGTGGTCAACC
AGGCCGGCGGCACCGAGATCGCCCGCTACGACCTCTCCGAGGACGCCGCCACCGAGACCGCCATGGTCTTCGGCGAGCTC
TACCGCAACGGCGCCGAATGGAAGTTCCGCGCCATCGGCCAGGGCTACGCCTCCGGCCTGGTCGGCATCGCCCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPGLTAVVVGLGWDVRTTTGTDFDLDASALLCTEQGKVRSDGDFVFFNNLKSADGSVEHTGDNL
TGEGDGDDEQVKVNLAAVPAEITRIVFPVAIYDAANRQQSFGQVRNAYIRVVNQAGGTEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAIGQGYASGLVGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-60 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-60 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-58 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-57 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-60 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-61 64
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-30 44
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-26 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-26 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KSE_58490 YP_004907575.1 putative tellurium resistance protein BAC0389 Protein 3e-60 65
KSE_58490 YP_004907575.1 putative tellurium resistance protein BAC0390 Protein 3e-59 63
KSE_58490 YP_004907575.1 putative tellurium resistance protein BAC0392 Protein 2e-25 42