Gene Information

Name : KSE_43920 (KSE_43920)
Accession : YP_004906131.1
Strain : Kitasatospora setae KM-6054
Genome accession: NC_016109
Putative virulence/resistance : Resistance
Product : putative tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 4856585 - 4857160 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
ATGCCCGTGAGCCTCTCCAAGGGTGGCAACGTCTCGCTGACCAAGGAGGCCCCCGGCCTGACCGCGGTCACCGTCGGCCT
CGGCTGGGACGTGCGCACCACCACCGGCGCCGAGTTCGACCTCGACGCCAGCGCGATCGTCCTGAACGGCGAAGGCAGGG
TCTACTCGGACCGGCACTTCGTGTTCTTCAACAACACCAGCACCCCGGACAGCACCGTCGTGCACACCGGCGACAACCGC
ACCGGCGAGGGCCAGGGCGACGACGAGCAGATCAACGTCAACCTCGCCGCGCTCCCCGCCGACGTGCAGCGGATCACCTT
CCCGGTGTCGATCTACGACGGCAACAACCGCGGCCAGAGCTTCGGCCAGGTCCGCAACGCCTACATCCGGGTGCTGAACC
AGGCCGGCGGCGCCGAGATCGCCCGCTACGACCTCTCCGAGGACGCCGCCACCGAGACCGCGATGGTCTTCGGCGAGCTC
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCCATCGGCCAGGGCTACGCCTCCGGCCTGGTCGGCATCGCCCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MPVSLSKGGNVSLTKEAPGLTAVTVGLGWDVRTTTGAEFDLDASAIVLNGEGRVYSDRHFVFFNNTSTPDSTVVHTGDNR
TGEGQGDDEQINVNLAALPADVQRITFPVSIYDGNNRGQSFGQVRNAYIRVLNQAGGAEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAIGQGYASGLVGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-57 63
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 61
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 61
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-58 61
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-58 60
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 59
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 59
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-57 58
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-31 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KSE_43920 YP_004906131.1 putative tellurium resistance protein BAC0390 Protein 7e-59 60
KSE_43920 YP_004906131.1 putative tellurium resistance protein BAC0389 Protein 2e-56 58