Gene Information

Name : KSE_29660 (KSE_29660)
Accession : YP_004904734.1
Strain : Kitasatospora setae KM-6054
Genome accession: NC_016109
Putative virulence/resistance : Virulence
Product : putative two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3340221 - 3340895 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
ATGACCTGTGTGCTGCTGGCCGAGGACGACCCGGCAATCTCCGAACCGCTGGCCCGCGCCCTGCGCCGCGAGGGCTACGA
GGTGCTCGTCCGCGAGGACGGACCGGCCGCCCTGGGCGCCGGCCTCAGCGAGGACGTCGACCTGATCGTGCTCGACCTCG
GGCTCCCCGAGATGGACGGCCTGGAGGTCTGCCGCCGGCTGCGCGCCGACGGCAAGAGCTTCCCCGTCCTGGTGCTCACC
GCCCGTGCCGACGAGGTGGACACCGTGGTCGGCCTGGACGCCGGCGCCGACGACTACGTCACCAAGCCGTTCCGGCTGGC
CGAACTGCTCGCCCGGGTCCGGGCGCTGCTCCGACGCGGCAACGTCGACCAGCTCACCACCGGCGCGCACGGCGTGAAGA
TCGACATCGAGTCGCACCGCGCCTGGCTCGGCGAGGAGGAACTCACCCTCTCCGCCAAGGAGTTCGAGCTGCTCCGGGTC
CTGGTCCGGGACGCCGGACGGGTCGTCACCCGCGAGGAGATCATGCGCCAGGTCTGGGACACCACCTGGTGGACCTCCAC
CAAGACCCTGGACATGCACATCTCCTGGCTGCGCAAGAAGCTCGGCGACGACGCCGCGAACCCGCGCTACATCGCCACCG
TGCGCGGCGTCGGCTTCCGCTTCGAGAAGAACTGA

Protein sequence :
MTCVLLAEDDPAISEPLARALRREGYEVLVREDGPAALGAGLSEDVDLIVLDLGLPEMDGLEVCRRLRADGKSFPVLVLT
ARADEVDTVVGLDAGADDYVTKPFRLAELLARVRALLRRGNVDQLTTGAHGVKIDIESHRAWLGEEELTLSAKEFELLRV
LVRDAGRVVTREEIMRQVWDTTWWTSTKTLDMHISWLRKKLGDDAANPRYIATVRGVGFRFEKN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KSE_29660 YP_004904734.1 putative two-component system response regulator BAC0083 Protein 2e-26 43
KSE_29660 YP_004904734.1 putative two-component system response regulator NC_002952.2859905.p0 Protein 9e-34 42
KSE_29660 YP_004904734.1 putative two-component system response regulator NC_009641.5332272.p0 Protein 8e-34 42
KSE_29660 YP_004904734.1 putative two-component system response regulator NC_013450.8614421.p0 Protein 8e-34 42
KSE_29660 YP_004904734.1 putative two-component system response regulator NC_003923.1003749.p0 Protein 1e-33 42
KSE_29660 YP_004904734.1 putative two-component system response regulator NC_007793.3914279.p0 Protein 8e-34 42
KSE_29660 YP_004904734.1 putative two-component system response regulator NC_002745.1124361.p0 Protein 8e-34 42
KSE_29660 YP_004904734.1 putative two-component system response regulator NC_009782.5559369.p0 Protein 8e-34 42
KSE_29660 YP_004904734.1 putative two-component system response regulator NC_002951.3237708.p0 Protein 8e-34 42
KSE_29660 YP_004904734.1 putative two-component system response regulator NC_007622.3794472.p0 Protein 9e-34 42
KSE_29660 YP_004904734.1 putative two-component system response regulator NC_002758.1121668.p0 Protein 8e-34 42
KSE_29660 YP_004904734.1 putative two-component system response regulator BAC0197 Protein 1e-21 42
KSE_29660 YP_004904734.1 putative two-component system response regulator AE000516.2.gene3505. Protein 6e-34 42
KSE_29660 YP_004904734.1 putative two-component system response regulator NC_012469.1.7685629. Protein 1e-30 41
KSE_29660 YP_004904734.1 putative two-component system response regulator BAC0638 Protein 3e-18 41
KSE_29660 YP_004904734.1 putative two-component system response regulator BAC0487 Protein 3e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KSE_29660 YP_004904734.1 putative two-component system response regulator VFG0473 Protein 7e-22 41
KSE_29660 YP_004904734.1 putative two-component system response regulator VFG0596 Protein 9e-21 41
KSE_29660 YP_004904734.1 putative two-component system response regulator VFG1390 Protein 3e-31 41