Gene Information

Name : KSE_29200 (KSE_29200)
Accession : YP_004904687.1
Strain : Kitasatospora setae KM-6054
Genome accession: NC_016109
Putative virulence/resistance : Virulence
Product : putative two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3283200 - 3283877 bp
Length : 678 bp
Strand : -
Note : Similar to DNA-binding response regulator MtrA in Mycobacterium tuberculosis (P0A5Z4).

DNA sequence :
ATGAAGGGACGTGTCCTCGTCGTCGATGACGACACCGCACTGGCCGAGATGCTCGGCATCGTGCTGCGGGGTGAAGGTTT
TGAGCCGTTTTTCGTCGCAGACGGGGACAAGGCGCTGGCCGCCTTCCGGGAGACCAAGCCGGACCTCGTACTGCTCGACC
TGATGCTGCCCGGACGGGACGGCATCGACGTGTGCCGGCAGATCCGGGCCGAGTCGGGCATCCCGATCGTCATGCTGACC
GCGAAGACCGACACGGTCGACATCGTGGTCGGCCTGGAGTCGGGCGCGGACGACTACGTGACGAAGCCGTTCAAGCCCAA
GGAACTGGTCGCCCGGGTGCGGGCCCGGCTGCGCCGGGCCGAGGAGCCGACGCCGGAGCAGCTGACCATCGGGGACCTGG
TGATCGACGTCGCCGGGCACTCCGTCAAGCGCGAGGGCCGCGGCATCCCGCTGACCCCGCTGGAGTTCGACCTGCTGGTC
GCGCTGGCCCGCAAGCCCTGGCAGGTGTTCACCCGCGAGGTGCTGCTGGAGCAGGTCTGGGGCTACCGGCACGCGGCCGA
CACCCGGCTGGTCAACGTGCACGTGCAGCGCCTGCGCTCCAAGATCGAGAAGGACCCGGAGCGCCCGGAGATCGTCGTCA
CCGTGCGCGGTGTCGGGTACAAGGCCGGGCCCGGCTGA

Protein sequence :
MKGRVLVVDDDTALAEMLGIVLRGEGFEPFFVADGDKALAAFRETKPDLVLLDLMLPGRDGIDVCRQIRAESGIPIVMLT
AKTDTVDIVVGLESGADDYVTKPFKPKELVARVRARLRRAEEPTPEQLTIGDLVIDVAGHSVKREGRGIPLTPLEFDLLV
ALARKPWQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRSKIEKDPERPEIVVTVRGVGYKAGPG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KSE_29200 YP_004904687.1 putative two-component system response regulator AE000516.2.gene3505. Protein 5e-76 75
KSE_29200 YP_004904687.1 putative two-component system response regulator NC_002952.2859905.p0 Protein 6e-39 45
KSE_29200 YP_004904687.1 putative two-component system response regulator NC_009641.5332272.p0 Protein 1e-38 45
KSE_29200 YP_004904687.1 putative two-component system response regulator NC_013450.8614421.p0 Protein 1e-38 45
KSE_29200 YP_004904687.1 putative two-component system response regulator NC_007793.3914279.p0 Protein 1e-38 45
KSE_29200 YP_004904687.1 putative two-component system response regulator NC_003923.1003749.p0 Protein 1e-38 45
KSE_29200 YP_004904687.1 putative two-component system response regulator NC_002745.1124361.p0 Protein 1e-38 45
KSE_29200 YP_004904687.1 putative two-component system response regulator NC_009782.5559369.p0 Protein 1e-38 45
KSE_29200 YP_004904687.1 putative two-component system response regulator NC_002951.3237708.p0 Protein 1e-38 45
KSE_29200 YP_004904687.1 putative two-component system response regulator NC_007622.3794472.p0 Protein 6e-39 45
KSE_29200 YP_004904687.1 putative two-component system response regulator NC_002758.1121668.p0 Protein 1e-38 45
KSE_29200 YP_004904687.1 putative two-component system response regulator HE999704.1.gene2815. Protein 5e-35 45
KSE_29200 YP_004904687.1 putative two-component system response regulator NC_012469.1.7686381. Protein 1e-35 44
KSE_29200 YP_004904687.1 putative two-component system response regulator BAC0125 Protein 7e-27 44
KSE_29200 YP_004904687.1 putative two-component system response regulator NC_012469.1.7685629. Protein 2e-38 43
KSE_29200 YP_004904687.1 putative two-component system response regulator BAC0039 Protein 4e-35 43
KSE_29200 YP_004904687.1 putative two-component system response regulator BAC0596 Protein 5e-35 43
KSE_29200 YP_004904687.1 putative two-component system response regulator CP000034.1.gene2186. Protein 4e-35 43
KSE_29200 YP_004904687.1 putative two-component system response regulator NC_002695.1.916589.p Protein 3e-35 43
KSE_29200 YP_004904687.1 putative two-component system response regulator CP001138.1.gene2239. Protein 5e-35 43
KSE_29200 YP_004904687.1 putative two-component system response regulator AE016830.1.gene1681. Protein 1e-34 42
KSE_29200 YP_004904687.1 putative two-component system response regulator BAC0197 Protein 4e-24 42
KSE_29200 YP_004904687.1 putative two-component system response regulator CP001918.1.gene3444. Protein 4e-34 42
KSE_29200 YP_004904687.1 putative two-component system response regulator AF155139.2.orf0.gene Protein 9e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KSE_29200 YP_004904687.1 putative two-component system response regulator VFG1390 Protein 1e-29 43
KSE_29200 YP_004904687.1 putative two-component system response regulator VFG1389 Protein 5e-25 43
KSE_29200 YP_004904687.1 putative two-component system response regulator VFG1702 Protein 4e-31 41