Gene Information

Name : KSE_24800 (KSE_24800)
Accession : YP_004904250.1
Strain : Kitasatospora setae KM-6054
Genome accession: NC_016109
Putative virulence/resistance : Resistance
Product : putative tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2756139 - 2756714 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
GTGGGTGTCAGCCTGAGCAAGGGCGGCAATGTCTCGCTCACCAAGGAGGCGCCCGGCCTGACCGCCGTGGTCGTCGGCCT
CGGCTGGGACGTGCGCACCACCACCGGCACGGACTTCGACCTGGACGCCAGCGCGCTGCTCTGCACCGAGCAGGGCAAGG
TCCGCTCGGACGCCGACTTCATCTTCTTCAACAACCTGAAGAGCGCCGACGGCTCGGTCGAGCACACCGGCGACAACCTC
ACCGGCGAGGGCGAGGGCGACGACGAGCAGGTCAAGGTCGACCTGGCGAACGTCCCGGCCGAGATCACCAAGATCGTCTT
CCCGGTGTCGATCTACGACGCGGAGAACCGGCAGCAGAGCTTCGGCCAGGTCCGCAACGCGTTCATCCGGGTGCTGAACC
AGGCCGGCGGCGCCGAGATCGCCCGCTACGACCTCTCCGAGGACGCCTCGACCGAGACCGCGATGGTCTTCGGCGAGCTC
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCGATCGGCCAGGGCTACGCGTCCGGCCTGCGCGGCATCGCCCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPGLTAVVVGLGWDVRTTTGTDFDLDASALLCTEQGKVRSDADFIFFNNLKSADGSVEHTGDNL
TGEGEGDDEQVKVDLANVPAEITKIVFPVSIYDAENRQQSFGQVRNAFIRVLNQAGGAEIARYDLSEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLRGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 68
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 68
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-59 68
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-63 67
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-58 67
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-60 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-60 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-60 65
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-26 43
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-26 43
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KSE_24800 YP_004904250.1 putative tellurium resistance protein BAC0389 Protein 4e-60 66
KSE_24800 YP_004904250.1 putative tellurium resistance protein BAC0390 Protein 9e-60 63
KSE_24800 YP_004904250.1 putative tellurium resistance protein BAC0392 Protein 1e-25 42