Gene Information

Name : KKY_2209 (KKY_2209)
Accession : YP_004899968.1
Strain : Pelagibacterium halotolerans B2
Genome accession: NC_016078
Putative virulence/resistance : Resistance
Product : ethidium bromide-methyl viologen resistance protein EmrE
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 2186995 - 2187321 bp
Length : 327 bp
Strand : +
Note : -

DNA sequence : 
ATGACCTATGTCTTTCTGCTCTGCGCCATCGTCGCTGAGGTGATCGCGACTTCCGCCCTCAAGGCCGCCAACGGCTTCAC
CAACCTTGTGCCATCTGTCATCGTGATCGTGGGCTATGCGGCGGCGTTCTATTTCCTATCGCTCACCCTGCGCACCCTGC
CGGTCGGCATCGCCTATGCGATCTGGTCGGGATTGGGGATCGTCCTGATCTCGCTCGTTGGCTGGGTGATCTACAGGCAG
GCGCTCGACCTGCCTGCAATTCTTGGCATGGGGCTGATCATTGCGGGGGTCATCGTCATCAACGCCTTTTCACGGGCGGG
GCACTGA

Protein sequence : 
MTYVFLLCAIVAEVIATSALKAANGFTNLVPSVIVIVGYAAAFYFLSLTLRTLPVGIAYAIWSGLGIVLISLVGWVIYRQ
ALDLPAILGMGLIIAGVIVINAFSRAGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-23 54
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-23 54
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-23 54
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-23 54
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-23 54
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-23 54
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-23 54
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-23 54
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-23 54
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-23 54
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-23 54
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-23 54
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-23 54
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-23 54
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-23 54
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-23 54
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-23 54
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-23 54
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-23 54
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-23 54
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-23 54
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-23 54
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-23 54
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-23 54
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-23 54
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-23 54
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-23 54
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-23 54
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-23 54
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-23 54
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 1e-15 44
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 1e-10 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE BAC0002 Protein 4e-29 63
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE NC_010410.6003348.p0 Protein 4e-29 63
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE CP001138.1.gene1489. Protein 1e-23 61
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE CP004022.1.gene1549. Protein 7e-21 58
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE BAC0377 Protein 4e-22 58
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE BAC0322 Protein 3e-26 57
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE NC_002695.1.913273.p Protein 3e-20 57
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE BAC0324 Protein 7e-26 57
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE BAC0150 Protein 3e-20 57
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE BAC0323 Protein 5e-24 54
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE BAC0192 Protein 2e-19 49
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE BAC0329 Protein 1e-17 46
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE BAC0327 Protein 1e-15 44
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE BAC0140 Protein 5e-14 43
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE BAC0326 Protein 1e-16 42
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE BAC0321 Protein 1e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE VFG1586 Protein 6e-16 44
KKY_2209 YP_004899968.1 ethidium bromide-methyl viologen resistance protein EmrE VFG1587 Protein 5e-11 41