Gene Information

Name : OBV_18370 (OBV_18370)
Accession : YP_004881541.1
Strain : Oscillibacter valericigenes Sjm18-20
Genome accession: NC_016048
Putative virulence/resistance : Virulence
Product : OmpR family two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1754500 - 1755207 bp
Length : 708 bp
Strand : +
Note : -

DNA sequence :
ATGGAACAGAAAAAAACCGTATTGATCGTGGAGGATGAAAAAAACATTGTAGACATCCTTTGCTTCAACCTTCAGCGGGA
GGGCTACACCACACTGGAGGCCTATGACGGCGAGGACGGCTTGAAAAAGGCACAGTCTGAAAAGCCGGATCTGATTTTGC
TGGACGTCATGCTGCCGAAAATGAATGGGTTCGATGTCTGCCGCACTCTGCGCAAGAGCCATAACAATGTGCCCGTGGTG
ATTTTGACTGCCCGGGAAGAGGAGACGGACAAGGTTCTGGGACTGGAAATCGGTGCGGATGACTATATCACAAAGCCCTT
CTCCATGCGGGAGCTGATCGCCCGGGTGGGAGCCAACATCCGCCGCATTGCCATGGGCGTGCCCGCGACGTCCGCCGCCG
AAGGGGCCATGACCATCGCCGGAGACCTCTCCATCAATACGGACAACCATCAGGTCTTCCGAAACGGAGCTGTGGTTGAT
CTGACCCAGCGGGAGTACGAGCTTTTGACGTTTCTGGCCAGCCACCCCAATAAAGTGTACGCCCGCACTGATCTGATGGA
ACAGGTTTGGAACTATGAATATGTGGGCGACGACGCCCGAACTGTGGATGTCACCGTCCGGCGGCTTCGGGAAAAAATCG
AGACGGATCCGGCCAATCCACGGTACATACTCACGAGGCGCGGGGTAGGATACTACTTTTCAACGTAA

Protein sequence :
MEQKKTVLIVEDEKNIVDILCFNLQREGYTTLEAYDGEDGLKKAQSEKPDLILLDVMLPKMNGFDVCRTLRKSHNNVPVV
ILTAREEETDKVLGLEIGADDYITKPFSMRELIARVGANIRRIAMGVPATSAAEGAMTIAGDLSINTDNHQVFRNGAVVD
LTQREYELLTFLASHPNKVYARTDLMEQVWNYEYVGDDARTVDVTVRRLREKIETDPANPRYILTRRGVGYYFST

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-33 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-40 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-40 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_012469.1.7685629. Protein 5e-55 54
OBV_18370 YP_004881541.1 OmpR family two-component response regulator HE999704.1.gene2815. Protein 1e-52 49
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_002951.3237708.p0 Protein 8e-53 48
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_003923.1003749.p0 Protein 7e-53 48
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_002758.1121668.p0 Protein 8e-53 48
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_009641.5332272.p0 Protein 8e-53 48
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_013450.8614421.p0 Protein 8e-53 48
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_007793.3914279.p0 Protein 8e-53 48
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_002745.1124361.p0 Protein 8e-53 48
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_009782.5559369.p0 Protein 8e-53 48
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_002952.2859905.p0 Protein 1e-52 47
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_007622.3794472.p0 Protein 1e-52 47
OBV_18370 YP_004881541.1 OmpR family two-component response regulator AE000516.2.gene3505. Protein 2e-42 45
OBV_18370 YP_004881541.1 OmpR family two-component response regulator HE999704.1.gene1528. Protein 1e-32 44
OBV_18370 YP_004881541.1 OmpR family two-component response regulator FJ349556.1.orf0.gene Protein 1e-44 42
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_012469.1.7686381. Protein 2e-47 42
OBV_18370 YP_004881541.1 OmpR family two-component response regulator AE016830.1.gene1681. Protein 2e-49 42
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_002952.2859858.p0 Protein 1e-34 41
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_007622.3794948.p0 Protein 1e-34 41
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_003923.1003417.p0 Protein 1e-34 41
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_013450.8614146.p0 Protein 1e-34 41
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_002951.3238224.p0 Protein 1e-34 41
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_007793.3914065.p0 Protein 1e-34 41
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_002758.1121390.p0 Protein 1e-34 41
OBV_18370 YP_004881541.1 OmpR family two-component response regulator NC_010079.5776364.p0 Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OBV_18370 YP_004881541.1 OmpR family two-component response regulator VFG0596 Protein 4e-34 42
OBV_18370 YP_004881541.1 OmpR family two-component response regulator VFG1702 Protein 5e-41 42
OBV_18370 YP_004881541.1 OmpR family two-component response regulator VFG1563 Protein 2e-40 41