Gene Information

Name : yceD (GYO_0494)
Accession : YP_004875838.1
Strain : Bacillus subtilis TU-B-10
Genome accession: NC_016047
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerD
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 426819 - 427400 bp
Length : 582 bp
Strand : +
Note : -

DNA sequence :
ATGGCAATTTCATTGGCAAAAGGACAAAAGGTAGATTTAACAAAAACAAATCCGGGTCTTTCAAAGGTTGTTGTCGGTTT
AGGCTGGGATACGAATAAGTATGACGGCGGGCACGACTTTGACCTTGACTCAAGTGTGTTTCTGTTAGACGCAGCAGGCA
AATGCGCGTCTCCAAACGATTTTATTTTCTACAACCAGCTTGAAGGCGGCAACGGTTCAGTCGTTCATTCAGGCGATAAC
CTGACTGGTGCTGGCGAAGGCGACGATGAGAATGTCAAAGTGAATCTCAGCGCAGTGCCTGCCAATATTGATAAAATCTC
ATTTGTTATCACCATTCACGACGCTGAAGCACGCAGCCAAAACTTCGGACAAGTATCAAACGCGTTCGTGCGCATCGTAA
ATGAAGAAACAAATGAAGAGCTCATCCGTTACGACCTTGCCGAAGATTTCTCTATTGAAACGGCAATTATTGCAGGGGAG
CTTTACAGACATAACGGCGAGTGGAAATTCTCAGCTATCGGCTCAGGCTACCAAGGCGGCCTTGCCCGCATCGCAACGGA
CTACGGTTTACAAGTCGGTTAA

Protein sequence :
MAISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSSVFLLDAAGKCASPNDFIFYNQLEGGNGSVVHSGDN
LTGAGEGDDENVKVNLSAVPANIDKISFVITIHDAEARSQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGE
LYRHNGEWKFSAIGSGYQGGLARIATDYGLQVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-50 59
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-49 58
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-49 58
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-49 57
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-41 52
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-41 52
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-41 52
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 6e-41 52
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceD YP_004875838.1 tellurium resistance protein TerD BAC0389 Protein 2e-49 59
yceD YP_004875838.1 tellurium resistance protein TerD BAC0390 Protein 2e-44 53
yceD YP_004875838.1 tellurium resistance protein TerD BAC0392 Protein 5e-25 41