Gene Information

Name : GLX_27540 (GLX_27540)
Accession : YP_004869536.1
Strain : Gluconacetobacter xylinus NBRC 3288
Genome accession: NC_016027
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 3064843 - 3065190 bp
Length : 348 bp
Strand : +
Note : -

DNA sequence :
ATGATTGGCGTGGGCAACGGCGTGCGTGTCTATCTGGCCTGCGGGGTGACCGATATGCGCAAGGGCATATCGGGTCTGGC
AGCACTGGCACAGGACGTGCTGCGTCAGAACCCGACATCAGGGGCGCTCTTTGCCTTTCGTGGTCGCCGTGGGGACAGGA
TCAAGCTTCTGATGTGGGACGGTCAGGGGTTCTGTCTTTATTACAAGGTGCTTGAGAAGGGACGTTTTCCATGGCCGTCT
CCGGCAGAGGGCGTTGCACGCCTGACGACAGCACAGATGGCCATGCTGTGGGAAGGCATGGAGTGGAGACGCCCTTCCTG
GTCTGCACCACCGTCTCGCGTGGCCTGA

Protein sequence :
MIGVGNGVRVYLACGVTDMRKGISGLAALAQDVLRQNPTSGALFAFRGRRGDRIKLLMWDGQGFCLYYKVLEKGRFPWPS
PAEGVARLTTAQMAMLWEGMEWRRPSWSAPPSRVA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-21 54
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-22 51
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 6e-22 51
unnamed AAC31493.1 L0014 Not tested LEE Protein 4e-22 51
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 6e-22 51
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 4e-22 51
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 6e-22 51
unnamed AAL99258.1 unknown Not tested LEE Protein 4e-22 51
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-22 51
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 4e-22 51
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-22 51
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-21 51
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-21 51
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-22 51
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-22 51
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-22 51
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 4e-16 50
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-24 50
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-24 50
unnamed AAL08461.1 unknown Not tested SRL Protein 7e-22 50
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-24 49
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 6e-21 49
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 6e-21 49
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 8e-21 46
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 8e-21 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GLX_27540 YP_004869536.1 transposase VFG0792 Protein 2e-22 51
GLX_27540 YP_004869536.1 transposase VFG1698 Protein 1e-22 51
GLX_27540 YP_004869536.1 transposase VFG1709 Protein 2e-22 51
GLX_27540 YP_004869536.1 transposase VFG1737 Protein 2e-22 51
GLX_27540 YP_004869536.1 transposase VFG1517 Protein 1e-16 50
GLX_27540 YP_004869536.1 transposase VFG1052 Protein 3e-22 50
GLX_27540 YP_004869536.1 transposase VFG1665 Protein 9e-25 49