Gene Information

Name : Bcoa_0658 (Bcoa_0658)
Accession : YP_004858658.1
Strain : Bacillus coagulans 36D1
Genome accession: NC_016023
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 700180 - 700857 bp
Length : 678 bp
Strand : -
Note : KEGG: bcq:BCQ_0637 response regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region; Signal transduction response regulato

DNA sequence :
ATGAAGCTGTTGATTGTGGAAGACAACGTATCCCTTTTGGAATCCATGAAGCGGATGCTCGAAGATGAATTCGAAGTGGA
AACCGCAAGAGACGGGGAAGAAGCGCTGTATCTTGCCCAGCAAAATATTTTCGACATTATCCTGCTTGATGTCATGCTGC
CGGAGATGGACGGCTTTTCGATATTAAAAACGTTGCGGAAAGACCGGGTCGAAACGCCGGTCCTGTTTGTGACGGCAAAA
GACTCGCTTGAGGACCGGGTCACAGGGCTTGAAATCGGGGGCGATGATTATATTGTCAAACCGTTCCAGGCTGCGGAACT
AAAAGCGAGGATCCGCGCATCGCTCAGACGATCGGGCAATATGACGATCGACCATACGCTCCGTTACCGCGGCATCGAGT
TATTCGGAAAAGAAAAAGAAATCAAAGTCGACGGCCAGCCGTTGAAACTGACGATCACACAATACGAACTGCTCGAATAC
CTGATCCAAAACAGCGGCAATATTTTAACGCGTGAACAGATTTTTGACCGGGTCTGGGGATTTGAAAGCGATACGACGAT
TGCGATTGTGGAAGTATACATCCACCATTTGCGGAAAAAGCTGGAACCGTTCGGCTATCATAAAGATATCCAAAATGTGC
GCGGGATTGGATACCTTTTAAAGGAGCCGGACAAATAA

Protein sequence :
MKLLIVEDNVSLLESMKRMLEDEFEVETARDGEEALYLAQQNIFDIILLDVMLPEMDGFSILKTLRKDRVETPVLFVTAK
DSLEDRVTGLEIGGDDYIVKPFQAAELKARIRASLRRSGNMTIDHTLRYRGIELFGKEKEIKVDGQPLKLTITQYELLEY
LIQNSGNILTREQIFDRVWGFESDTTIAIVEVYIHHLRKKLEPFGYHKDIQNVRGIGYLLKEPDK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-34 41
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-38 41
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-29 41
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-29 41
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-29 41
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-29 41
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-29 41
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-29 41
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-29 41
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-29 41
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-29 41
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-29 41
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 1e-18 41
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-21 41
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-21 41
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 1e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcoa_0658 YP_004858658.1 winged helix family two component transcriptional regulator VFG0596 Protein 7e-35 41