Gene Information

Name : NH8B_2345 (NH8B_2345)
Accession : YP_004847573.1
Strain : Pseudogulbenkiania sp. NH8B
Genome accession: NC_016002
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2462311 - 2462991 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
ATGAAGATCCTCATCGTCGAAGACGAACCCAAGACAGGGAGCTATCTCAAGCAAGGGTTGGCCGAGTCTGGTTTTGTCAC
GGACCTCGAAAATGATGGCCATGGGGGGCTTCAGCAAGCATTGTCAGGAGGGTACGACCTCGTCGTGCTCGATGTCATGT
TGCCAGGGTTGAATGGCTGGGAAGTTCTTCAGAAGCTACGCCAAGCGGGCTGTACTGTGCCAGTTTTATTCCTGACAGCC
CGCGATCAGGTAGAGGATAGGGTGAAGGGGTTGGAGCTTGGAGCCGATGATTATCTCATCAAGCCATTTGCTTTTTCTGA
ACTCCTGGCGCGGGCGCGTACTTTGCTACGCAGGGCATCTGTCGCGCCACAGCCGCACACGCTGAGCATAGCCGATTTGG
AGCTTGATCCGACTCGCAGGCGTGTTATGCGTGCGGGGCAAAGAATCGCGGTAACGGCCAAGGAATTCACTCTACTTGAA
CTGCTAATGCGTCGACAAGGTGAAGTATTGTCCCGCTCGCTTATCGCTTCCCAGGTATGGGACATGAATTTTAATGGCGA
CACGAACGTCATCGACGTGGCGGTCAAGAGGCTCCGCGCCAAGGTTGACGATGAATTTCCGGTAAAGCTGATTCACACCG
TACGAGGCATGGGCTACGTACTAGATGCCTTGGCACCATGA

Protein sequence :
MKILIVEDEPKTGSYLKQGLAESGFVTDLENDGHGGLQQALSGGYDLVVLDVMLPGLNGWEVLQKLRQAGCTVPVLFLTA
RDQVEDRVKGLELGADDYLIKPFAFSELLARARTLLRRASVAPQPHTLSIADLELDPTRRRVMRAGQRIAVTAKEFTLLE
LLMRRQGEVLSRSLIASQVWDMNFNGDTNVIDVAVKRLRAKVDDEFPVKLIHTVRGMGYVLDALAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-53 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-52 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator BAC0638 Protein 3e-63 71
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator BAC0083 Protein 7e-68 69
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator BAC0197 Protein 2e-65 66
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator BAC0125 Protein 2e-61 61
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator BAC0111 Protein 1e-62 61
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-61 60
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator BAC0347 Protein 1e-56 59
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 2e-30 44
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 8e-28 43
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 7e-32 42
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 7e-32 42
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 7e-32 42
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 7e-32 42
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 7e-32 42
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 7e-32 42
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 7e-32 42
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 7e-32 42
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 3e-27 41
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 8e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-53 57
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator VFG1390 Protein 1e-36 43
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator VFG1386 Protein 8e-34 43
NH8B_2345 YP_004847573.1 two component heavy metal response transcriptional regulator VFG1389 Protein 1e-28 41