Gene Information

Name : phoP (LRC_06190)
Accession : YP_004831851.1
Strain : Lactobacillus ruminis ATCC 27782
Genome accession: NC_015975
Putative virulence/resistance : Virulence
Product : Alkaline phosphatase synthesis two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 667867 - 668595 bp
Length : 729 bp
Strand : +
Note : -

DNA sequence :
GTGTTTTTTTTGAAAAAAATTTTGGTCGTTGACGATGAAAAGGCGATCGTGACTCTGTTAGAATATAATTTGAAGAAGGC
AGGCTATAGCGTCGACACCGTTTCTGAAGGCGTCAGCGCTTATAATATGGCCGTGACCGGGAAATATGATTTTATTTTGC
TCGATCTGATGCTTCCCGGAATGGACGGAATTGAAATAACGAGACGTTTGCGTCAGGAACGAATCGAAACACCGATTATC
ATTTTAACTGCTCGTGATCAAGAGTATGATAAGATCATCGGACTTGAACTTGGAGCGGATGACTATTTGACGAAACCTTT
TTCTCCAAGAGAAGTTATCGCAAGAATCAAAGCAATCAGTCGCCGGATAACGTCATCATCAGATGAGGGTGGCGCAAGTC
AGCCGGCCAAGGTCGAAAAGGAATTTTATGAATATGCCGGATTTACCGTTGATTTGGCCAAAGTTTCAGTGACAAGAAAC
GGAGAACGCGTAAAGCTTACGCCAAAAGAATTTGAATTACTGGCCTATTTTGTCAAGCGTCCGGGAAGAGTCCTCAGTCG
CGAAAAGCTTCTGAACGGTGTCTGGGGTTACGACTACGTTGGCCAGACGCGCATGGTCGACATGCATGTCAGTCATCTTA
GAGAAAAGCTCGAAGACGATCCGAAGCACCCTGTTTATATTCAGACCGCTAGAGGATTCGGTTATCGTTTTAACGGTGAT
GCTAAATGA

Protein sequence :
MFFLKKILVVDDEKAIVTLLEYNLKKAGYSVDTVSEGVSAYNMAVTGKYDFILLDLMLPGMDGIEITRRLRQERIETPII
ILTARDQEYDKIIGLELGADDYLTKPFSPREVIARIKAISRRITSSSDEGGASQPAKVEKEFYEYAGFTVDLAKVSVTRN
GERVKLTPKEFELLAYFVKRPGRVLSREKLLNGVWGYDYVGQTRMVDMHVSHLREKLEDDPKHPVYIQTARGFGYRFNGD
AK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-39 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator AE016830.1.gene1681. Protein 7e-66 55
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator HE999704.1.gene2815. Protein 1e-60 55
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_002952.2859905.p0 Protein 2e-53 47
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_013450.8614421.p0 Protein 2e-53 47
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_007793.3914279.p0 Protein 2e-53 47
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_007622.3794472.p0 Protein 2e-53 47
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_002745.1124361.p0 Protein 2e-53 47
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_009782.5559369.p0 Protein 2e-53 47
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_002951.3237708.p0 Protein 2e-53 47
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_003923.1003749.p0 Protein 1e-53 47
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_002758.1121668.p0 Protein 2e-53 47
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_009641.5332272.p0 Protein 2e-53 47
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_012469.1.7686381. Protein 6e-58 47
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_012469.1.7685629. Protein 2e-44 46
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator CP000034.1.gene3671. Protein 1e-42 42
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_007793.3914065.p0 Protein 3e-36 41
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_002758.1121390.p0 Protein 3e-36 41
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_010079.5776364.p0 Protein 3e-36 41
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_002952.2859858.p0 Protein 3e-36 41
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_007622.3794948.p0 Protein 3e-36 41
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_003923.1003417.p0 Protein 3e-36 41
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_013450.8614146.p0 Protein 3e-36 41
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator NC_002951.3238224.p0 Protein 3e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator VFG1386 Protein 6e-39 44
phoP YP_004831851.1 Alkaline phosphatase synthesis two-component response regulator VFG1563 Protein 7e-40 41